SecReT6
Protein ID: 597515127
SecReT6 ID899
T6SS typei2
Gene symbol-
Locus tagBN49_2463
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]2565068..2566612 [+]
Product-
NoteTssC
UniProt IDW9B7Z4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.10E-168, Aligned region: 90..510
Protein Sequence: 514 a.a.     [Download]
>gi|597515127|ref|CDO14219.1| - [Klebsiella pneumoniae]
MLMSVTTENAPVQGQTTLQENSAGEGVYASLFEKINLTPASRLGDINDFLDDAALSEAPAAERLTAAMQV
FMERIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWRGLKQLVDNTDYRQNVKTE
ILDVAKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISRVSAAA
HMPFIGAVGPAFFLKETMEEVAAIKDIGNYFDRAEYIRWKAFRETDDARYIGLVMPRVLGRLPYGPDTVP
VRSFNYVEQVKGPDHEKYLWTSAAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVK
IPSEVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRI
AHYLKMIQRENIGTTKDRRLLELNTWVRSLVTEMTDPGDELQASHPLHDASVVVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|597515127|emb|FO834906.1|:2565068-2566612
atgctaatgtctgttaccacagaaaacgcccctgttcaggggcaaaccacgctgcaggaaaacagcgcgg
gcgagggcgtttacgcctcgctgtttgaaaaaattaatctcaccccggcgtctcgcctcggggatatcaa
cgactttctggacgatgccgcgctctccgaggcgccggcggcggaacgtctcaccgcggcgatgcaggtg
tttatggaacgcatccgtcagtccggccagcgggtggaaaagctcgacaaaacgctgatcgaccaccata
tcgccgagctggatttccagataagccgtcagctggacgcggtgatgcaccatcaggagtttcagcaggt
cgaatccctgtggcgcggcctcaaacagctggtggacaacaccgactatcggcagaacgtcaaaacggag
atcctcgacgtcgccaaagacgatctgcgccaggactttgaggacgcgccggagcttatccagagcggcc
tctactggcacacctataccgcggagtatgacactcccggcggcgagccgatcggctcggtgatctcggc
ctatgagttcgacgccagcccgcaggatgtggcgctgctgcgcaatatctcccgcgtctctgcggccgcc
catatgccgtttatcggcgccgtcggcccggccttcttcctgaaagagaccatggaagaggtggctgcca
ttaaggatatcggcaactacttcgatcgtgcggaatatatccgctggaaggcgtttcgcgaaactgacga
tgcccgctacatcggtctggtgatgccgcgcgtgctgggtcgtctgccgtacggtccggacaccgtgccg
gtgcgcagcttcaactatgtcgagcaggtgaaaggtccggaccacgaaaagtatctctggaccagcgcgg
cgttctccttcgcttccaatatggtgaagagctttgtcaataacggctggtgcgtgcaaattcgcggtcc
gcaggccggcggcgcggtgaaagatctgcccatccatctgtacgatctgggcaccggcaaccaggtgaaa
attccttccgaggtgatgatcccggaaacgcgggagtttgagttcgccagcctgggctttatcccgctgt
cgtactacaaaaatcgcgattacgcctgcttcttctcggccaactccgcgcagaaaccggcgctgtacga
taccgccgacgccaccgccaacagccgtatcaacgcgcgtctgccttatatcttcctgctgtcgcgcatc
gcgcactacctgaagatgatccagcgcgagaatattggcaccaccaaggaccggcgtctgctggagctga
acacctgggtgcggagcctggtgaccgaaatgaccgaccccggcgacgagctgcaggcctcccatccgct
gcacgatgccagcgtggtggtggaagatatcgaggataacccgggcttcttccgcgtgaagctgtacgcg
gtgccgcacttccaggtcgaggggatggacgtcaatctgtcgctggttagccagatgccaaaggcgaagg
cgtag