SecReT6
Protein ID: 597515128
SecReT6 ID899
T6SS typei2
Gene symbol-
Locus tagBN49_2464
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]2566622..2567965 [+]
Product-
NoteTssK
UniProt IDW9B7B5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.70E-135, Aligned region: 19..444
Protein Sequence: 447 a.a.     [Download]
>gi|597515128|ref|CDO14220.1| - [Klebsiella pneumoniae]
MMKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARMGLNHPWGVVEATFEPEMLKLGRLQAHRLQVRFQ
DGTMIDTDNADALPSALSLDGASGEAVIVLALPLMQANGGNCLKPEEVAERPVRFRQRWRDVRNQFGDDT
RQIAVIQPELILRFAHQDNSDYLTCPLVRLQRDSQGAWLIDETFLPPLLQIQGSRWLATQLEQLLVQLRA
RLTRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGYFLRYRQSPPERLYPELARLAGSLLTFSL
THQANAVPIYQHDQLNAVFPPLFDLLNDLLEASLPSRVVAIALEHDVRLHFWQARLHDARLREGADYYLS
VRSSVPVAQLQEQFLHQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEM
LQSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|597515128|emb|FO834906.1|:2566622-2567965
atgatgaaaacggaacgtccgttgtggggccggggcattatggtgtcgcctcagcattttcaacagcagg
ctgcgtatgcagcctggactgcggaagtgattgcccggatgggtcttaaccacccctggggagtggttga
ggcgaccttcgaaccagagatgctcaaactgggccgcctgcaggctcacaggctgcaggtccggttccag
gatggcacgatgattgatacggacaatgccgatgcgctgccgtccgcgctgtcgctggacggcgcgtccg
gcgaggcggtgatcgtgctggcgctgcccctgatgcaggcgaatggcggcaactgtctgaagccggagga
ggtggccgaaaggccggtgcgcttccggcagcgctggcgcgatgtccgtaaccagtttggggatgatacc
cggcagattgccgtcatacagccggagctgatcctccgcttcgcccaccaggacaacagcgattacctga
cctgtccgcttgttcgcctgcagcgggactcgcagggggcctggcttatcgacgagacgtttctcccgcc
gctgctgcagatccagggcagccgctggctggcgacgcagcttgaacagctgctcgtccagctccgggct
cgtctgacgcgcctgatggccatgcgtcgcgaaagcaatgaacggatggctgattttgccgtagccgatg
tctctctgttctggttgctgaatgcgctgaacagcgccgaaccggtgctggggtactttctgcgttaccg
gcaaagcccgccggaacgcctctacccggagctggcgcgcctggctggtagcctgctgaccttttcgctc
acccatcaggcgaatgccgtcccgatctatcagcatgaccagctgaacgcggtttttccgccgctgtttg
atttactgaacgacctgctggaggcgagcctgccatcgcgggtggtggcgattgcgctggagcatgatgt
ccggctgcacttctggcaggcgcgtctgcacgatgcccggctgcgggaaggggctgattactacctgtcg
gttcgttcgtcggtaccggtcgcccaactgcaggagcagtttctgcaccagtgcaaagtgggcagtccgg
atcatgtcaaagccatcgtcaactcctcgcggacaggggtgcccctcacgccattgcgtcatgtgccggc
ggcgatcccgctgcgtctggaaaatcagtatttcagcctcgatgtgtcccaccctctggcaacggaaatg
ctgcagagcggcacctgtatgttttacgtcccggggatgctcggtgagcctgaacttgaactttttgcgg
tactacgaacgtga