SecReT6
Protein ID: 597515131
SecReT6 ID899
T6SS typei2
Gene symbol-
Locus tagBN49_2467
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]2570344..2570625 [+]
Product-
NoteTssD
UniProt IDW9BFV1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.50E-18, Aligned region: 11..93
Protein Sequence: 93 a.a.     [Download]
>gi|597515131|ref|CDO14223.1| - [Klebsiella pneumoniae]
MESNSMAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEI
DASSPYLYKAVTTGQTLKSAEFK
 
Nucleotide Sequence: 282 bp     [Download]
>gi|597515131|emb|FO834906.1|:2570344-2570625
atggagagtaattccatggcaattcctgtttatctttggctgaaagacgacggcggcgcggacattaaag
ggtctgtcgacgttcaggatcgtgaaggcagtatcgaagtggtggctcaggagcataacctgtacatccc
gaccgataacaacaccggcaaactgaccggcacgcgtattcatacgccgttcctgttcaccaaggagatc
gacgcctccagcccctacctgtacaaggcagtgaccaccggccagaccctgaaatccgctgagttcaagt
ag