SecReT6
Protein ID: 597515132
SecReT6 ID899
T6SS typei2
Gene symbol-
Locus tagBN49_2468
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]2570653..2570850 [+]
Product-
NoteTssD
UniProt IDW9B7Z8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.30E-08, Aligned region: 2..49
Protein Sequence: 65 a.a.     [Download]
>gi|597515132|ref|CDO14224.1| - [Klebsiella pneumoniae]
MEYFNTKLENVKVVKVNPLMHDIKNPAYEKHNHLEQIELRYEKITWTYKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 198 bp     [Download]
>gi|597515132|emb|FO834906.1|:2570653-2570850
gtggagtatttcaataccaaacttgagaacgtcaaggtggtgaaagtgaatcccctgatgcacgacatca
aaaaccccgcctacgagaagcacaaccatctggaacagattgagctgcgctacgagaagatcacctggac
ctataaagacggcaacatcattcactccgatagctggaacgaacgcgccaccgcgtaa