SecReT6
Protein ID: 597515133
SecReT6 ID899
T6SS typei2
Gene symbol-
Locus tagBN49_2469
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]2571115..2573769 [+]
Product-
NoteTssH
UniProt IDW9B7B9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 236..255
AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 610..775
AAA [PF00004], Evalue: 1.50E-19, Aligned region: 238..350
AAA [PF00004], Evalue: 1.50E-19, Aligned region: 615..736
AAA_5 [PF07728], Evalue: 1.50E-14, Aligned region: 238..258
AAA_5 [PF07728], Evalue: 1.50E-14, Aligned region: 614..734
ClpB_D2-small [PF10431], Evalue: 2.30E-13, Aligned region: 197..213
ClpB_D2-small [PF10431], Evalue: 2.30E-13, Aligned region: 383..406
ClpB_D2-small [PF10431], Evalue: 2.30E-13, Aligned region: 784..855
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 139..156
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 215..260
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 452..511
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 583..650
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 631..709
AAA_16 [PF13191], Evalue: 3.50E-11, Aligned region: 754..799
AAA_25 [PF13481], Evalue: 1.30E-08, Aligned region: 238..310
AAA_25 [PF13481], Evalue: 1.30E-08, Aligned region: 292..325
AAA_25 [PF13481], Evalue: 1.30E-08, Aligned region: 363..403
AAA_25 [PF13481], Evalue: 1.30E-08, Aligned region: 610..643
AAA_22 [PF13401], Evalue: 2.60E-08, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 2.60E-08, Aligned region: 611..633
AAA_22 [PF13401], Evalue: 2.60E-08, Aligned region: 675..708
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 216..253
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 290..387
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 607..626
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 684..696
AAA_19 [PF13245], Evalue: 2.40E-06, Aligned region: 235..260
AAA_19 [PF13245], Evalue: 2.40E-06, Aligned region: 610..636
IstB_IS21 [PF01695], Evalue: 8.00E-06, Aligned region: 232..296
IstB_IS21 [PF01695], Evalue: 8.00E-06, Aligned region: 614..634
NACHT [PF05729], Evalue: 1.60E-05, Aligned region: 238..266
NACHT [PF05729], Evalue: 1.60E-05, Aligned region: 614..638
Zeta_toxin [PF06414], Evalue: 4.40E-05, Aligned region: 232..262
Zeta_toxin [PF06414], Evalue: 4.40E-05, Aligned region: 600..654
Clp_N [PF02861], Evalue: 6.10E-05, Aligned region: 22..58
Clp_N [PF02861], Evalue: 6.10E-05, Aligned region: 105..121
Sigma54_activat [PF00158], Evalue: 8.10E-05, Aligned region: 222..252
Sigma54_activat [PF00158], Evalue: 8.10E-05, Aligned region: 614..731
AAA_17 [PF13207], Evalue: 0.00027, Aligned region: 238..302
AAA_17 [PF13207], Evalue: 0.00027, Aligned region: 613..649
AAA_14 [PF13173], Evalue: 0.00072, Aligned region: 238..339
AAA_14 [PF13173], Evalue: 0.00072, Aligned region: 612..696
AAA_33 [PF13671], Evalue: 0.0026, Aligned region: 238..255
AAA_33 [PF13671], Evalue: 0.0026, Aligned region: 394..437
AAA_33 [PF13671], Evalue: 0.0026, Aligned region: 613..635
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 239..260
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 615..636
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 712..732
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 851..883
AAA_29 [PF13555], Evalue: 0.0038, Aligned region: 232..254
AAA_29 [PF13555], Evalue: 0.0038, Aligned region: 610..625
AAA_18 [PF13238], Evalue: 0.0043, Aligned region: 238..260
AAA_18 [PF13238], Evalue: 0.0043, Aligned region: 615..644
Protein Sequence: 884 a.a.     [Download]
>gi|597515133|ref|CDO14225.1| - [Klebsiella pneumoniae]
MENPASLLRRLNPCCARAMEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDALWQDLL
SWLDKQPRSVRHRPQLSDHTLRLMQEAWLIASLSGEAQIRSVHLLMALVEKQNLIQCDGLWPLLTLGQRQ
LERLRPLLDAQSDERPPAQQEAALAQPHGGDVEFVGRPAGSELNADGLNPALQNALDKFTLDVTAKARDG
LIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDALKPVSVRTLDLGLL
QAGAGVKGEFEQRLKNIIEAVQQSPSPVLLFIDEAHTIIGAGNQGGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYADHHGVHITDDAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTASARLRMSLDTVPEPLTRMKAQLTALAMEKQALLEDIALGNSARGDRLAAIEQEEIRLI
LALDTLETQYGQELQLTEALLACRRDISRQAEINDLQTALIAVQQGNPLLGLDVDVRTVATVIADWTGVP
LSSLMKDEQTELLSLEESLGKRVVGQEAALSAIARRLRAAKTGLTPENGPQGVFLLVGPSGTGKTEKALA
LADALFGGEKALITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVM
NLFYQVFDRGVMRDGEGREIDFRNTVILMTANLGSDLLMQLLDEQPEASESDLHELLRPVLRGHFQPALL
ARFQTVIYRPLPAGALRAIVGMKLGQVSQRLACHYGITTTLSESLFDALTEACLLPDTGARNVDSLLNQQ
ILPALSQQLLSHMAAGQKPRQVTLGYHEEEGVVMAFDEGTISDE
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|597515133|emb|FO834906.1|:2571115-2573769
atggaaaatccagccagcctgttacgccgtcttaatccctgctgtgcccgcgcaatggagggggcggcct
ccctgtgccagacccgggcgcatgccgagatcctgcccgagcactggctgctcaagctgctggaacaggg
ggaaggtgatctgacggtgctggcgcggcgctatgaatgggatatggatgcgctgtggcaggatctgctg
agctggctggataaacagccgcgctcggtacgtcatcgtccccagctctctgaccataccctgaggctga
tgcaggaggcctggctgattgcctctctcagcggcgaagcgcagatccgcagtgttcacctgctgatggc
gctggttgaaaaacagaatctgatccagtgcgatggcctgtggccgctgttaacgctgggccagcgtcag
ctggaacgcctgcgccccttgctggatgcccagtccgacgaacgtccgccagcgcagcaggaagcggcgc
tggcgcagccccatggcggggacgtggaatttgtggggcgtcccgcgggcagcgaactgaatgcggatgg
gctcaacccggcgctgcagaacgcgctggacaaattcactctcgacgtcaccgccaaagccagagacggc
ctgattgacccggtgttcggacgtgacacggaaatccgccagatggtggatattctctcccgtcgacgta
aaaacaacccgatcctcgtcggtgagccgggcgtgggcaagaccgctctggtggaaggcctggcgctgcg
cattgccgaaggcaacgtccccgacgcgctgaagccggtgtcggtgcgcaccctcgacctcggtctgctg
caggccggcgccggggtcaaaggcgagttcgagcagcggctgaaaaatatcattgaggcggtacagcagt
cgccttcgccggtgctgctgtttatcgacgaggcgcacacgatcatcggcgcgggtaatcaggggggcgg
cgcggatgccgccaacctgctgaagccggcgctggcccggggcgaactgcggaccatcgccgccaccacc
tggtctgaatacaagcagtacttcgagcgcgacgccgcgctggagcgccgctttcagatggtcaaggtgg
atgagccggacgacgacaccgcctgcctgatgctgcgcggcctgaagtcccgctatgccgaccaccacgg
cgtgcatatcacggatgatgcggtgcgcgccgccgtgacgctgtcacgacgctatctcaccggtcgccag
ctgccggacaaggcagtggatttactcgacaccgcttccgcccgcctgcgtatgagtttggataccgtgc
ctgagccgctgacccgcatgaaggcgcagctcaccgcgctggcaatggagaagcaggcgctgctggaaga
tattgcgctgggcaacagcgcccgcggcgatcggctggcggccattgagcaggaggagatccgccttatt
ctggcgctggatacccttgaaactcagtatggtcaggagctgcagctgacggaagcgctgctcgcctgtc
gccgcgatatctcccgccaggcggaaattaacgacctgcaaaccgcgcttatcgccgtccagcagggcaa
tccgctgctcgggctggacgtcgacgtccgcaccgtggcgacggtgattgccgactggaccggcgtgccg
ctctcctcgctaatgaaagatgagcagacggagctgctgagtctggaagagagtctcggcaaacgggtgg
ttggccaggaggcggccctgagcgctattgcccggcgcctgcgcgccgcgaaaaccggcctgacgccgga
gaacggtccgcaaggggtgttcctgctggtcgggccgagcggcaccggcaaaacggaaaaggcgctcgcc
ctggccgatgcgctgttcggcggcgagaaagcgctgatcaccatcaatctctccgagtaccaggagccgc
acaccgtcagccagctgaagggttctccgcccggctacgtcggctacggccagggcgggatcctgaccga
ggcggtgcgcaaacgcccctacagcgtggtgctgctcgatgaggtggaaaaggcccatcgcgatgtgatg
aacctgttctaccaggtcttcgaccggggggtaatgcgcgacggcgaggggcgtgaaatcgactttcgca
acacagtgatcctgatgaccgccaacctcggaagcgacctcctgatgcagttgctggatgaacagccgga
ggccagtgaatcagacctgcacgagctgctgcgcccggtgctgcgcggccacttccagccggcgctgctg
gcccgcttccagacggtgatttaccgtccgctgccggcgggagcgctgcgcgccattgtcggcatgaagc
tcgggcaggtaagtcagcgtctggcttgccattacggaatcaccaccaccctcagcgagagcctgttcga
cgcgctgaccgaggcctgcctgctgccggataccggcgcccgcaacgtcgacagtctgctgaatcagcag
atcctgccggcactgagtcagcagctattgagccatatggcggcggggcagaaaccgcgccaggtgacgc
tggggtatcacgaagaggaaggcgtcgtgatggcgtttgacgaggggacaatatccgatgagtag