SecReT6
Protein ID: 597515134
SecReT6 ID899
T6SS typei2
Gene symbol-
Locus tagBN49_2470
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]2573762..2574139 [+]
Product-
NoteTssI
UniProt IDW9BP38
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.60E-14, Aligned region: 34..125
Protein Sequence: 125 a.a.     [Download]
>gi|597515134|ref|CDO14226.1| - [Klebsiella pneumoniae]
MSSVKSLLFSHNHHLLSVKGCEAGLDVLAFEGDEALSQPFRYRIEFTSADHAISKEMMLMKAASLTLQAP
VAQGFGINVQQPLRVIQGVVTGFERLSTSRDETHYALTLQPRLALLNRSHQNAIY
 
Nucleotide Sequence: 378 bp     [Download]
>gi|597515134|emb|FO834906.1|:2573762-2574139
atgagtagcgtgaaatcgttgttgttcagccacaaccaccacctgctttcggtgaagggatgtgaagccg
ggcttgatgtgctggccttcgagggcgatgaagccctgagccagccgttccgctaccgtattgaattcac
cagcgcagaccatgccatcagcaaagagatgatgctgatgaaggcagcctccctgacgctgcaggcgccg
gtggctcagggcttcggcatcaatgttcagcaacccttgcgggtgatccagggcgtggtgacggggtttg
aacggctcagtacctccagggatgaaacgcactacgcgctgacgcttcagccgcgcctggcgctgcttaa
ccgctcgcaccagaacgccatttactag