SecReT6
Protein ID: 597515135
SecReT6 ID899
T6SS typei2
Gene symbol-
Locus tagBN49_2471
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]2574161..2576257 [+]
Product-
NoteTssI
UniProt IDW9BGC5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.10E-40, Aligned region: 3..223
DUF2345 [PF10106], Evalue: 6.20E-38, Aligned region: 431..431
DUF2345 [PF10106], Evalue: 6.20E-38, Aligned region: 475..625
T6SS_Vgr [PF13296], Evalue: 7.00E-33, Aligned region: 356..461
T6SS_Vgr [PF13296], Evalue: 7.00E-33, Aligned region: 497..529
Phage_base_V [PF04717], Evalue: 1.00E-16, Aligned region: 206..225
Phage_base_V [PF04717], Evalue: 1.00E-16, Aligned region: 256..349
Protein Sequence: 698 a.a.     [Download]
>gi|597515135|ref|CDO14227.1| - [Klebsiella pneumoniae]
MEKILRERHGLRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADTRLHIDVAEFCDS
QQGYEKGLTLPSVPPSGQQSAGVDAVWEMACRHRVVEQQVSTRDYNYREATADMNAQVDVTRGETTTFGE
AYHWGDNYLTAGNAHDRHPAPESGAFYARLRHERYLNGQTRMQATTSCPTLCPGQVLKVTGGEEVAGEFA
DGVLITAMHSHARRDADFAVEFAGIPDSPDVGYRPEPGARPVMAGTLPARVTSTRENDTYGHIDKHGRYR
VNMLFDRARWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVT
IRNDKRNVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDSDRQPRGEGFELRTDSRGAIRAQ
KGIFISADGQAQAQGQVLAMEPALALLSAALLEMESLAASALQAQALAADVSRQQKLLKQKIEQLHGEVI
LGSAPKGIALVSGEDMQFSASDNLTLTAGKQLDVGAHKDFTMAVGKQLSLFSRGGVKLFSSQNDIDIQAQ
GGNITTWSTEDTHISSGRKMVITAQDELTLICGGGYIKITGGNVEIGGSGKLLIKNSGIKKAGAGSMQGV
MRSFEPSTFDEKFIIRNALTKEPLPGRAYKITMPDGSVVSGVTDDSGATSLNSSEVIDNMNISLVKAK
 
Nucleotide Sequence: 2097 bp     [Download]
>gi|597515135|emb|FO834906.1|:2574161-2576257
gtggaaaaaatcctccgcgagcgccacggcctgcgcggtcaggattttctgttctcgctgacaaaaacgt
atccgcgccgcgagcaggtgatgcagtacggcgaggatgacctgcgctttatcacccggctgctgggtga
ggtggggatctggtttcggtttaccgccgacacgcggctgcacatcgacgtcgctgagttctgcgacagt
cagcagggctatgagaaggggctgacgttgccttcggtcccgccgtcagggcagcagtcggccggggtgg
acgcggtgtgggagatggcatgccgccaccgcgtcgtggagcagcaggtcagtacccgcgactacaacta
ccgcgaggcgacggcggacatgaacgcgcaggtggatgtcacccgcggggagaccaccacctttggtgag
gcttaccactggggagataactacctgaccgcggggaatgcccatgaccgccatccggcgccggagtccg
gggcgttttacgcccggcttcggcatgagcgttatcttaacggccagacccggatgcaggccaccaccag
ctgcccgacgctctgcccgggacaggtgctgaaggtcaccggcggagaggaggtggccggggagtttgct
gatggcgtgctcatcacggcgatgcacagccacgcccggcgcgatgccgactttgcggtggagtttgccg
gcataccggacagcccggacgtcggctaccggcctgagcccggcgcgcgtccggtgatggccgggacgct
gccggcccgcgtgaccagcacccgggaaaacgacacctacgggcatatcgacaaacacgggcgctaccgg
gtgaatatgctgtttgaccgggcgcgctgggaaaccgggttcgagagcctgtgggtccgccagtcgcggc
cgtatgccggagacacctacggtctgcacctgccgctgctggcggggacggaggtggcgattggctttga
ggatggtaaccccgaccggccgtatatcgcgggcgtgctgcacgactcggcgcacggcgaccacgtcacc
atccgcaatgacaaacgtaacgtcctgcgcaccccggccaacaacaaaatccgcctcgacgatgagcgcg
ggaaagaacatatcaaggtcagcacggagtacggcggtaaaagccagctgaacctggggcacctggtgga
cagtgacaggcagccgcgcggcgaaggctttgagctgagaaccgacagccggggagctatccgggcacag
aaagggatatttatcagcgcggacggacaggcgcaggctcaggggcaggtgctggcgatggagccggccc
ttgccctgctttcagcggcattactggagatggaatcccttgccgccagcgcacttcaggctcaggccct
ggctgctgatgtcagtcgtcagcaaaaactcctgaagcagaaaattgaacaactgcatggggaggtgatc
cttggcagtgcgccgaaaggaattgccctggtgagcggtgaagatatgcagttttcggccagcgataatc
tgactcttactgcaggtaaacagctcgatgttggtgcacataaggactttaccatggcggtaggtaagca
actgagtctgtttagtcgtggaggtgtcaaactattcagctcgcaaaatgatattgatattcaggctcag
ggagggaatatcactacttggtcgacggaggatacgcatatttcaagtggcagaaaaatggtcattacag
cacaggatgaactgacgctgatatgcggtggcggctatatcaaaatcactggtgggaatgttgaaattgg
cggatcgggcaaactgctgattaagaattcggggataaagaaagcaggcgctggcagtatgcagggtgtt
atgaggtcgtttgaaccctcaacatttgatgaaaaatttataatcagaaatgcgctgactaaagaaccac
tgccagggagagcatacaaaattactatgccagatggttcagttgtttctggtgtaacagatgattctgg
agcaacgtcactcaattcatctgaggttatcgacaatatgaacataagcttggttaaggcgaaataa