SecReT6
Protein ID: 597515140
SecReT6 ID899
T6SS typei2
Gene symbol-
Locus tagBN49_2476
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]2584412..2586004 [+]
Product-
NoteTssA
UniProt IDW9BGC8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-21, Aligned region: 66..126
Protein Sequence: 530 a.a.     [Download]
>gi|597515140|ref|CDO14232.1| - [Klebsiella pneumoniae]
MSILQNLVAASQLDESVLRQQARSRQAQWQSWLAPISDAQPTGDDPGYDDDFQRIRDEVNKISGVDTELI
CQLAEKLLTQTCKDLRVITFYVWARLQRDGETGLAEGVTLLAAMLERFGAMLHPQRERSCKSALEWLGSR
RMSDSLSLYPEVDMTTMQVIIGALLLAEATFSGLAEASRPDLSGLYQILENRLVQSGGAHSLVPQTSREE
HDLLPQHTDTAPVMHTVTSGRDLLDQAKVLAKYLRECPGGWLAGHHLMKSVRWDTLTELPPLDASGRTRL
LPPKPESKAHLKRLYLQKSWSELLEHTDTLLAQGVNHLWLDVQWYAWQALLKLDADSVRADILCRDMKGL
LARLPGLETLAFNDGTPFADEVTLNWLNERVLDEMAGWQDEPVMAATSADEVLSLEPEVLTRADDEGIES
ALNWLQAQPGYTTSRNRWLMRLLMARVSEQYGKNEMALHLLAELDSRAREMTLEQWKPELIFEVKARRLR
LLRGKAGRSEAEKNRLLPEMESLLAGLIALDPARAAVLCA
 
Nucleotide Sequence: 1593 bp     [Download]
>gi|597515140|emb|FO834906.1|:2584412-2586004
atgagcattttacaaaatttggttgccgccagtcagttggatgaaagcgtactgcgccagcaggcccggt
cacgtcaggcgcagtggcagtcctggcttgcgccaatcagtgacgcccaaccaaccggggacgatccggg
ctatgacgatgattttcagcgtatccgcgatgaggtcaataagatctccggcgtcgataccgaactgatt
tgccagctggcagaaaaactgctgactcagacctgcaaggatctgcgcgtgatcaccttttacgtgtggg
cgcgtctgcagcgggatggtgaaaccggtctggcggagggcgttacgctgctggcggcaatgcttgagcg
gtttggggctatgctccatccccagcgtgaacgtagctgtaaatcagcgctggaatggcttggcagtcgc
cggatgtcggacagtctgtctctttatccggaagtcgacatgaccactatgcaggtcattatcggggcgt
tattgctggcggaagccactttttccggcttggctgaagcatctcgccccgatctttccgggctatatca
gatactggagaaccgcctggtgcaaagcggcggagcccacagtctggtgccgcagaccagccgcgaagaa
cacgatctgctaccccaacatacggacaccgcaccggtaatgcataccgtcacgtcaggtcgtgatttgc
tcgatcaggctaaggtgctggcgaaatatctgcgcgagtgtcccggcggatggctggcaggtcatcatct
gatgaagagtgtgcgttgggatacgttaacggagttaccgccgctggatgcctccggccggacacggcta
ttgcctcccaagcctgagagtaaagcccatcttaagcggttgtatttacagaaaagctggtcggaactgc
tggagcatacggacacgctgttggcgcaaggcgtcaaccatctgtggctggatgtgcagtggtacgcctg
gcaggcgctgctgaaactggatgctgacagtgtacgggccgatatcctgtgccgggatatgaaagggcta
ttggctcgtctgccggggctggaaaccctggcgtttaacgatggtacgccattcgccgatgaagtgacgc
tcaactggcttaacgaacgtgtcctggatgagatggccggatggcaagatgagccggtaatggcggcgac
cagcgctgatgaggtgctgtcgctggagccagaagtgctcacccgcgcggacgatgaaggtattgagtcg
gcgctgaactggttacaggcgcagccgggctataccaccagccgcaatcggtggctgatgcgcttactga
tggcgcgggtcagcgagcagtacggaaaaaatgaaatggcgctgcatctgctggcggaactcgacagccg
cgcccgggaaatgacgctcgaacaatggaagccggagcttatctttgaggtcaaagcccgccgactccgg
ctgctcagaggcaaggccgggcgcagtgaggcagaaaaaaatcgcttgctgccagaaatggagtcattgc
ttgccgggctcatcgctctggatcctgctcgcgccgcggtgctgtgcgcataa