SecReT6
Protein ID: 597515141
SecReT6 ID899
T6SS typei2
Gene symbol-
Locus tagBN49_2477
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]2586083..2587837 [+]
Product-
NoteTssF
UniProt IDW9BFV7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-180, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|597515141|ref|CDO14233.1| - [Klebsiella pneumoniae]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPFVERLFEGFAFLMGRMREKLDDDLPE
LTEGVVSLLWPHYLRTIPSMSVVEFTPDWPEMKESMTIGKGFEVLSRPIGEKGTRCRYTTTKAIALQPLS
LERVQLATDTDGRSVITLRFTCSQLTDWRRVDLSHIPLYCNADAPLACAMHEAFTLNVARMWLRMPDEVD
RRPLDGYFSALGFGEDDGLWPEDGRSFRGYQLLLEYFTFREKFMFIDLRGLETVAFPAGLAWFEIDVVLA
ERWEHDFRFSEKQLRLHCVPVINLFPLESDPLTINSLQTEYPLRPMRVQDGHTEIYTVDSVISSHQQVYA
PFSSFRHKGGMMRHDAADYYYHTRVRRGPSGLYNTWLIVGGEAFDNHTVPEDESLSLTLTGTNGQLPRRA
LQSTVLDTVMKTTSASIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSSFLSLMDNAEVLRGTLALYEWTD
SEMNRRRLEAILDVKHRATERFAQGHLVRGVQIEVTLDSHGFAGRGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHSRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|597515141|emb|FO834906.1|:2586083-2587837
atggacgatttaaccctgcgttattacgacgctgaaatgcgctacctgctggaagcgggtgaagagtttg
cccgcgctcatcctgagcaggcggcaatgctcaatctcgacaaagcgggcgcccgcgacccctttgtcga
gcgcctgtttgaaggttttgccttcctgatgggccgcatgcgcgagaaactcgatgacgatctgcctgag
ctgaccgaaggcgtggtcagtctgctgtggccacattatttacgtaccattccctcgatgtcggtcgtgg
agttcacccccgactggccggaaatgaaagaatcgatgacgataggcaaaggttttgaagtgctttcccg
gccgatcggtgaaaagggcacgcgctgccggtacaccaccaccaaagcgatcgctctgcagccgttatcc
ctggaacgcgtccagctggccaccgatacggatggccggtcggtgatcacgctgcgctttacctgcagcc
agctgacggactggcgccgggtcgatctcagtcatatcccgctgtactgcaacgccgatgcgccgctggc
ctgcgccatgcacgaggcctttaccctcaatgtggcccggatgtggctgcgcatgcccgatgaggtggac
agaaggccgctggacgggtatttcagcgcgctgggatttggcgaggatgacggcctctggcctgaagatg
gccgcagttttcgcggttaccagctgctgctggagtattttaccttccgcgaaaagttcatgttcatcga
tctgcgcgggctggagacggtggcttttccggccggactggcgtggtttgaaatcgacgtcgtgctggcg
gaacgctgggaacatgacttccgcttcagcgaaaagcagctgcgcctgcactgcgtgccagtgatcaacc
tgtttccgctggagtccgatccgctgaccatcaattccctgcagaccgaatacccgctgcgcccgatgcg
cgtgcaggacggccacaccgaaatttacaccgtcgattccgtgatctcctcacaccagcaggtttacgcg
ccgttctcaagttttcgccacaaaggcggcatgatgcgtcatgacgcggcggactattactatcataccc
gggtgcgccgtggcccctccgggctgtacaacacctggcttatcgtcggcggagaagcctttgataatca
taccgtaccggaagatgaaagcctgtcgctgaccctcaccggaaccaacggccagctgccgcgtcgcgcg
ctgcagagcaccgtgctcgatacggtgatgaaaaccacttccgccagtattgcagtgcgtaacctctgcg
cgccgacgctgccgtgctatccccccgcccaggaccgttttcactggcgggtgctgagccatctgggcag
cagttttctttccctgatggataacgcggaggtcctgcgcggcaccctggcgctgtatgaatggaccgac
agcgagatgaatcgtcggcgtctggaagccatcctcgacgtgaagcaccgcgcaacagagcgctttgcac
agggccatctggtgcgcggcgtacagattgaagtcaccctcgacagtcacggctttgccggacgaggcga
tatatgcctgtttggcgagatgcttagccgcttcttcgcgctctacaccgacatctacttgttcaaccgc
ctgattatcattctgcaaccaaccggagaacgactggaatgggaagagaagcacagccgccgcattcccg
gctga