SecReT6
Protein ID: 597515142
SecReT6 ID899
T6SS typei2
Gene symbol-
Locus tagBN49_2478
StrainKlebsiella pneumoniae str. Kp52.145
Repliconchromosome [GenBank: FO834906] [Browse all T6SS(s) in this replicon]
Location [Strand]2587801..2588886 [+]
Product-
NoteTssG
UniProt IDW9B806
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.90E-73, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|597515142|ref|CDO14234.1| - [Klebsiella pneumoniae]
MGREAQPPHSRLTPRLEADLPRINFYRFCQLLEKRRPGQPLMGGTSHPADDPVRFYPHPGMGFPASELKA
VEYDEADDSRPPVIRTTFMGLYGVDSPLPTAYLDDIAQHREGHEALQGLLDIFSHRIMTQFYRIWRKYSW
PATFEPGGTDRLSQSLLGLAGLGIPGTTQHIASPASRFLALTGVLRQPGKTQQGIQALVTLLAPETTVRV
SPYSLRPVAISQPLGFYGDDDFFLDGNTPLGDEAMDASSQLLVALTTDNPAEAQGWKPDGPLFRDFLILL
RVYLGWRFRANITLTAPTRLLAVPPLGDEPFWLGMNGVLGVGEGESEGDIPQTFTTELGTYTGLQPATFL
QGNRRVTYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|597515142|emb|FO834906.1|:2587801-2588886
atgggaagagaagcacagccgccgcattcccggctgaccccgcgactggaggccgacctgccgcggatca
atttttaccgcttctgccagcttctggaaaaacggcgtcccggccaaccgctgatggggggaaccagcca
tccggctgacgatccggtgcgtttttacccgcatccgggaatgggatttcccgccagcgaactgaaagcc
gtggaatacgatgaggccgatgacagcaggccgccggtcattcgcaccacctttatggggttgtacggtg
tcgattcgccgctcccgacggcatatctcgatgatatcgcccagcacagggaagggcatgaagcgctgca
gggcttactggatatcttcagccaccggatcatgacgcagttttaccgcatctggcggaaatactcctgg
cccgccacctttgagcccggcggcaccgatcgtctctcgcagtcgctactgggcctggcggggctgggca
tccccggcacgacgcagcatatcgcctcgccggcgtcgcgctttctggcgctaaccggcgtgctgcgtca
gccgggcaaaacccagcaggggatccaggcgctggtcaccctgctggccccggagaccaccgtcagggtg
agcccgtacagcctgcgtccggtggcgatcagccagccgctggggttttacggcgatgacgacttcttcc
tggacggcaatacgccgctgggtgacgaagcgatggatgccagcagccagctcctcgtcgcccttaccac
cgacaatcccgcggaggcgcagggctggaagcctgacggcccgctgtttcgggactttctcatcctgctg
cgggtatacctcggctggcgattccgggccaacatcaccctgaccgcgccgacccgactgctggctgtcc
cgccgctgggggacgagccgttctggctcggtatgaacggcgtgctgggcgtgggtgagggcgagagtga
gggcgatattcctcagacctttaccaccgagctgggtacctatacgggcctgcagcctgccacctttcta
caaggaaaccgacgtgttacgtataagtttgactaa