SecReT6
Protein ID: 60681491
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2003
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2346972..2347865 [-]
Producthypothetical protein
NoteTssP
UniProt IDQ5LDV4
KEGG IDbfs:BF2003
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 2.20E-12, Aligned region: 42..98
PKD [PF00801], Evalue: 2.20E-12, Aligned region: 143..179
Protein Sequence: 297 a.a.     [Download]
>gi|60681491|ref|YP_211635.1| hypothetical protein BF2003 [Bacteroides fragilis NCTC 9343]
MMNKFLNTKVLYIFISVIILIMFFLLVMRACSQKQPIQATVTPSDPVVGEEIFFSDSTSGARIWYWEFGN
NETSTQRSGYHRFKQKGVYKIRLTVNGNLERYFDVRVKEKTNAEDLHLVHIIAPKEAIQGENIIFRGEGH
DEQWRWEFGETGMIDSREKTALYAYTEPGEYEVLLNTENTRYPIRHRINILPYYSENDSTDVMVLIGLDI
KEKLQNIADGKPFNVNYNYVVDKYFNNNPNTLVIVNNNKYNDFYSYCQGLHHIGRKETIIQNVIVETEDE
ESGYITQITVMQIEKKK
 
Nucleotide Sequence: 894 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2347865-2346972 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGATGAATAAATTCCTAAATACGAAGGTTCTCTATATCTTTATCTCCGTTATCATACTTATTATGTTTT
TTCTGCTGGTAATGAGAGCTTGCTCGCAGAAGCAGCCGATTCAGGCTACTGTAACTCCGTCTGACCCTGT
CGTGGGGGAAGAAATATTTTTTTCCGATTCCACGTCGGGAGCGAGAATCTGGTACTGGGAGTTCGGAAAC
AACGAGACATCCACACAACGCAGCGGATACCATCGGTTCAAGCAAAAAGGGGTGTACAAAATACGACTGA
CCGTCAACGGAAATCTGGAACGCTACTTTGATGTGAGAGTAAAAGAGAAGACCAATGCGGAAGACCTGCA
TCTGGTTCATATCATAGCTCCCAAGGAAGCCATTCAGGGAGAAAATATCATCTTCCGTGGCGAAGGACAC
GACGAACAATGGCGCTGGGAGTTCGGAGAGACGGGGATGATTGATTCCCGTGAAAAAACGGCTCTTTATG
CTTATACCGAACCCGGAGAGTACGAAGTATTGCTTAATACGGAGAATACCCGGTATCCCATCAGACACCG
GATAAACATTCTGCCCTACTATTCGGAGAATGATTCTACCGATGTAATGGTGCTCATCGGTTTAGACATC
AAAGAGAAGTTGCAGAACATTGCAGACGGTAAACCCTTTAATGTAAACTACAACTATGTCGTGGACAAGT
ATTTTAATAATAACCCGAACACGCTGGTTATTGTCAACAACAATAAATATAACGACTTTTATTCTTATTG
CCAAGGACTGCACCATATCGGCAGAAAAGAAACGATTATCCAGAATGTCATCGTAGAGACGGAGGATGAA
GAGAGCGGATATATTACCCAAATAACGGTTATGCAAATCGAAAAAAAGAAATGA