SecReT6
Protein ID: 60681492
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2004
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2347862..2348389 [-]
Producthypothetical protein
NoteTssO
UniProt IDQ5LDV3
KEGG IDbfs:BF2004
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 175 a.a.     [Download]
>gi|60681492|ref|YP_211636.1| hypothetical protein BF2004 [Bacteroides fragilis NCTC 9343]
MSITPKNKSSKTVSERERFIGFVYVLTLFIVITGACGFILFKYAGTRHIFSNKIMVIKKMERQKEFQNIQ
SVQIVSADTLFSRIEQFEPGVNASYEENDIKFLINDLAKQWERNSFDKRNKMFWHLASVYEMWFADKKEL
WSKQDNIIKFKKNLEECEVGLQKKEGELKNKGGKP
 
Nucleotide Sequence: 528 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2348389-2347862 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGAGCATAACCCCTAAAAATAAAAGCAGCAAAACCGTTAGCGAGCGTGAACGCTTTATCGGATTTGTAT
ATGTGCTTACCCTGTTTATTGTTATCACAGGAGCCTGTGGATTTATTCTTTTCAAGTATGCAGGGACACG
CCACATCTTCTCCAATAAAATAATGGTCATTAAAAAGATGGAGCGGCAAAAGGAATTTCAAAATATACAA
TCAGTACAGATTGTGAGCGCAGATACCCTATTTTCACGTATTGAACAGTTTGAGCCGGGCGTCAATGCCT
CTTATGAGGAAAATGATATCAAGTTCCTGATAAACGACCTTGCCAAACAATGGGAAAGAAACAGTTTTGA
CAAGCGCAATAAGATGTTCTGGCATCTCGCTTCGGTATATGAAATGTGGTTTGCCGACAAGAAAGAACTA
TGGAGCAAGCAGGATAACATAATAAAATTCAAGAAAAATCTGGAGGAGTGCGAAGTCGGACTCCAGAAGA
AGGAAGGCGAACTTAAAAATAAAGGAGGCAAGCCATGA