SecReT6
Protein ID: 60681494
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2006
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2348911..2349867 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ5LDV1
KEGG IDbfs:BF2006
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-10, Aligned region: 177..298
Protein Sequence: 318 a.a.     [Download]
>gi|60681494|ref|YP_211638.1| hypothetical protein BF2006 [Bacteroides fragilis NCTC 9343]
MEHRLPKEIKGFLPPNTMDTDFKAELYGALLSEAGFDTAQIMMVRDGNNLSNVSKDIRSVKHRNHVGIAE
GAYIELKTNRRGIYDSLPEGLFHEALFPGKVKDLGLILEEMQQHRNEEFFIRRFFSLLESEVDREGIQAQ
LLELRYDKKNKYSDYAKLFAACWPVIHILSRQGALLFIKFMPHIHSIRGRLEEVSDALSQILEAPVKVRP
KMVQRTIRAQKPNRLGNMRLGANSVNVGVLNSAEADLHIHIGDLPTREVERFLPGNRSRKALEMLADIFL
GAWQEFDVTVSVSPDERKTYLKPTGDASPCYLRINTYL
 
Nucleotide Sequence: 957 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2349867-2348911 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGGAACATCGCTTACCCAAAGAGATAAAGGGGTTTCTTCCGCCCAATACAATGGACACCGACTTCAAGG
CAGAGCTATACGGAGCCTTGCTGTCGGAAGCCGGGTTCGACACCGCTCAAATTATGATGGTGCGTGACGG
TAATAACCTGAGCAATGTTTCGAAAGATATCCGATCGGTGAAGCATAGGAATCATGTCGGCATAGCGGAG
GGGGCATACATAGAACTAAAGACCAACCGCCGGGGGATTTATGATTCGCTGCCGGAGGGATTGTTCCATG
AGGCGCTCTTTCCCGGCAAGGTGAAAGATTTGGGACTTATTCTGGAAGAGATGCAGCAACATCGTAACGA
AGAGTTCTTTATCCGACGTTTTTTCAGCCTGCTGGAGAGCGAAGTGGACAGAGAAGGGATACAGGCACAA
TTGCTCGAATTGCGGTATGATAAAAAGAACAAATATTCTGATTATGCGAAACTCTTTGCCGCTTGCTGGC
CGGTCATTCATATTTTGTCCAGACAGGGGGCGTTGCTGTTCATCAAGTTCATGCCGCATATCCATTCGAT
CCGGGGCAGACTGGAAGAGGTAAGCGACGCACTGTCGCAGATTCTGGAAGCTCCGGTAAAGGTACGCCCC
AAAATGGTGCAACGGACAATAAGGGCACAAAAACCGAACCGGCTGGGGAACATGAGACTGGGAGCAAACA
GTGTGAATGTGGGGGTGCTTAATAGTGCTGAGGCTGATTTGCATATACACATAGGCGACCTGCCAACTCG
GGAAGTCGAAAGGTTCCTGCCCGGCAACCGCTCCCGCAAAGCCCTTGAAATGCTGGCGGATATTTTTCTT
GGCGCGTGGCAGGAGTTCGATGTGACGGTCAGCGTTAGCCCTGACGAACGCAAGACTTATTTAAAACCGA
CGGGTGACGCCAGTCCGTGTTACCTCAGGATAAACACTTATTTATAA