SecReT6
Protein ID: 60681495
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2007
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2349869..2351011 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ5LDV0
KEGG IDbfs:BF2007
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.00018, Aligned region: 163..209
Protein Sequence: 380 a.a.     [Download]
>gi|60681495|ref|YP_211639.1| hypothetical protein BF2007 [Bacteroides fragilis NCTC 9343]
MAKKNLVNWSDCMPLSAAIFNQHDDYFLDSIRDSIEVRTNSYNYGLLPARQNRDGENGIRISQHVTGHIE
VRLKYCDAVTASGIRIQFDATETGSELVKNYSVESDTRKNITQWDIILSVDPFHRVGSGDPNPEEVPPRH
PNALPSYRLFVMPKGEINISELGSHYLTIGRIRKDAERFMVDADFIPPCTTMKSHPELQEYHAKFGNMFR
SLENYSKIIIAKIHNRDNRGELGVHISLICREMLRYLATLQFTYTNKGLYNAPIDVLDSVSSLAHIMYVS
FSYLSGTQKEETQKYFYEWSDVTPGSFDEQLADTLEMLYEHTDIRASMVRAYSFMYTLTELWQRLSTLEY
IGQHKENIVVSERTTGNNTTGQNKTWSIMD
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2351011-2349869 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGGCAAAGAAAAATTTAGTAAACTGGTCGGACTGTATGCCGCTGTCAGCCGCCATCTTCAACCAACATG
ACGATTACTTTCTGGATAGCATTCGCGATAGCATAGAAGTACGAACCAACAGTTATAACTACGGGCTGTT
GCCCGCACGGCAAAACAGGGATGGCGAAAACGGCATCCGTATCAGCCAGCACGTGACCGGACACATCGAA
GTGCGGCTGAAATACTGCGATGCGGTCACCGCTTCGGGTATCCGCATCCAATTTGATGCCACCGAAACGG
GAAGCGAATTAGTGAAGAACTATTCTGTAGAATCGGATACCCGTAAGAATATCACGCAATGGGACATTAT
CCTCTCCGTGGATCCGTTCCACCGGGTAGGCTCGGGTGACCCCAATCCGGAGGAAGTTCCACCCCGCCAT
CCGAACGCCTTGCCCTCCTATCGGTTGTTTGTGATGCCCAAAGGAGAAATCAATATCAGTGAACTGGGTT
CCCATTACCTGACCATCGGACGTATCCGCAAGGATGCCGAACGATTCATGGTAGATGCCGACTTTATCCC
GCCCTGTACGACGATGAAAAGCCACCCTGAACTGCAAGAGTATCATGCCAAGTTCGGAAATATGTTCCGC
TCACTGGAGAATTACAGCAAAATTATCATAGCCAAAATACATAATAGGGATAATCGCGGCGAACTGGGTG
TGCACATCTCTCTGATATGTCGGGAGATGCTCCGCTACCTCGCCACCCTGCAATTCACTTATACCAATAA
AGGGCTGTACAATGCTCCTATTGATGTACTGGATTCCGTATCGAGTCTGGCACATATCATGTATGTAAGT
TTCAGCTACCTATCAGGGACGCAAAAGGAGGAAACGCAGAAATATTTCTACGAGTGGAGCGACGTAACGC
CCGGTTCGTTCGACGAGCAACTCGCCGATACGTTGGAGATGCTGTACGAACATACGGATATCCGGGCTTC
GATGGTTCGTGCCTATTCGTTTATGTACACACTTACCGAATTGTGGCAACGGCTCAGTACGCTGGAATAT
ATCGGTCAGCATAAGGAGAATATTGTGGTATCGGAACGCACTACGGGGAACAATACTACGGGACAGAACA
AAACATGGAGCATAATGGATTGA