SecReT6
Protein ID: 60681496
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2008
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2351039..2351887 [-]
Producthypothetical protein
NoteTssN
UniProt IDQ5LDU9
KEGG IDbfs:BF2008
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 282 a.a.     [Download]
>gi|60681496|ref|YP_211640.1| hypothetical protein BF2008 [Bacteroides fragilis NCTC 9343]
MNSFFQTLAFTYLLYPILGLLLVGLGIFIAKKNALLNNKRLVGYTIGAITLLTLPALLGFLDYGFMPYGY
IFLTMLYLLLGSYNIRMISWVYKDDYKYRHEIILTGFILVVSMLFFTLVFNLCNELKYGLWASTCLLPFV
IVSVFIRTYRIFIAIPIPVYEVWRYTDDTEQDGYFDPGSLQVLQIELYKQESDREPVKLSVKAPDEMQFG
TWFHRMIDDYNLKSPQARIDDYAAKEGGWIFYRKPTLLSPRHYIDFNLTVKDNRIRSRDVIVAKRVMEHN
EN
 
Nucleotide Sequence: 849 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2351887-2351039 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGAATTCATTCTTCCAAACCCTCGCCTTCACCTACCTGCTCTACCCGATACTGGGATTGTTACTGGTAG
GCTTAGGCATTTTCATAGCAAAGAAAAACGCTCTGCTGAACAACAAGCGGCTGGTAGGCTATACTATTGG
TGCAATCACACTCTTGACACTCCCTGCCTTACTGGGATTCCTTGATTACGGTTTCATGCCCTACGGCTAC
ATCTTCCTTACCATGCTGTATCTTCTTCTGGGCAGTTATAACATACGAATGATTTCATGGGTGTATAAGG
ACGACTACAAGTATCGCCACGAAATCATACTCACCGGTTTTATACTGGTGGTATCCATGTTGTTCTTCAC
CCTTGTCTTCAATCTCTGCAATGAATTAAAATACGGTCTGTGGGCATCCACCTGCCTGCTTCCATTCGTC
ATTGTCTCGGTATTTATCCGCACCTACCGTATCTTTATCGCCATTCCGATTCCCGTGTATGAAGTATGGA
GATACACAGACGATACCGAGCAGGACGGATATTTTGACCCGGGCAGCCTGCAAGTCCTGCAAATAGAGCT
ATACAAACAAGAAAGTGACCGGGAACCGGTCAAGCTCAGTGTGAAAGCACCCGACGAAATGCAATTCGGC
ACATGGTTCCACCGGATGATTGACGACTATAATCTGAAGTCTCCACAAGCCCGGATAGACGACTATGCAG
CAAAAGAGGGAGGATGGATTTTCTACCGGAAACCCACCTTGCTATCTCCCCGACATTACATAGACTTCAA
CCTTACCGTAAAGGATAACCGCATCCGCAGCCGTGATGTAATTGTTGCTAAACGGGTAATGGAACATAAT
GAGAACTAA