SecReT6
Protein ID: 60681500
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2012
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2356980..2357648 [-]
Producthypothetical protein
NotePAAR
UniProt IDQ5LDU5
KEGG IDbfs:BF2012
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 5.70E-17, Aligned region: 17..88
Protein Sequence: 222 a.a.     [Download]
>gi|60681500|ref|YP_211644.1| hypothetical protein BF2012 [Bacteroides fragilis NCTC 9343]
MKQIVTINLNHICPMVTGVTPHIGGPIIGPGCPGVMVNGVPISVMGDMCVCCGPPDTIVQGEPGILVNGK
PIVLQGCMTAHGGIIPAGVPGVTVSSASPIEPITMNHVSPKRNRFLAAISGNNLQEAIENQNALQKKMLE
EEPMIFNVHWEKEDIHIAESHINKKVTVNADTIGFKDGETVKFVITPEAIDTANGEQVEDIELTGTVNNN
HVTVEWIVELKK
 
Nucleotide Sequence: 669 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2357648-2356980 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGAAACAAATCGTTACTATAAATTTAAATCATATTTGCCCGATGGTAACAGGGGTGACACCTCATATTG
GAGGGCCTATTATCGGTCCAGGATGCCCCGGTGTAATGGTTAATGGAGTTCCTATATCTGTTATGGGTGA
TATGTGTGTATGTTGTGGTCCGCCCGACACTATTGTACAAGGAGAACCGGGAATCTTGGTTAATGGTAAA
CCTATCGTATTACAAGGCTGTATGACTGCTCACGGAGGAATTATCCCTGCGGGAGTACCCGGAGTAACAG
TAAGCAGTGCCAGTCCTATAGAACCAATCACGATGAATCATGTATCACCGAAAAGGAATAGATTTTTGGC
TGCGATTTCTGGCAATAACTTGCAAGAAGCCATCGAAAATCAGAATGCTCTGCAAAAAAAAATGTTAGAG
GAGGAACCTATGATATTTAATGTGCATTGGGAAAAAGAAGATATACATATCGCAGAAAGTCATATCAATA
AAAAAGTTACAGTAAACGCTGATACTATAGGATTTAAGGATGGAGAAACTGTGAAATTTGTAATTACCCC
TGAGGCTATAGATACAGCGAATGGAGAACAGGTCGAGGATATTGAGTTAACAGGAACTGTTAACAATAAC
CATGTTACTGTCGAATGGATTGTAGAATTAAAAAAATGA