SecReT6
Protein ID: 60681501
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2013
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2357670..2359520 [-]
Producthypothetical protein
NoteVgrG
UniProt IDQ5LDU4
KEGG IDbfs:BF2013
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 4.00E-14, Aligned region: 372..455
Phage_GPD [PF05954], Evalue: 1.10E-09, Aligned region: 61..190
DUF2345 [PF10106], Evalue: 1.90E-06, Aligned region: 502..608
DUF3540 [PF12059], Evalue: 0.0012, Aligned region: 6..34
DUF3540 [PF12059], Evalue: 0.0012, Aligned region: 394..435
DUF3540 [PF12059], Evalue: 0.0012, Aligned region: 502..536
DUF3540 [PF12059], Evalue: 0.0012, Aligned region: 548..605
Protein Sequence: 616 a.a.     [Download]
>gi|60681501|ref|YP_211645.1| hypothetical protein BF2013 [Bacteroides fragilis NCTC 9343]
MASTNLDAVSVEIKVAGKVCDYVTMELFQSVSTHHRFKIKVNYRPDKPSVWAIGPDVIFKQLGEKVSIIM
THHESGEKTEFHGLISDIHVEGFDGNQGFVILEGGSPTILLDRDPAMDCYVEQNLNTIVSDILDKSGVKM
NVTNNPKHTDIIPYVARYKETSYGFLSRLLRSYGEWFYYNGETLQIGDPEIDTESRAGYDVDLTGVSINA
TIRSLNHSTYEFDPVNDKFYYDYSGTPKGATLGSRSAEKCSEPIFPTEAKLPSIRPAYSAMDLEHYGDAG
FHRNYSQLSQIKASSRYCGIRLGELVVTRVPESFPGVKITDLGRYRITEITHTVNYKGQYSNTFCGVPGG
TPIMPWGDAVMPVAYPEMARVVSNDDPKNQGRVKVQFMWQEVDGGESYWMRVQSPDAGKSEQVAKNRGFV
FIPEPGDLVMVGFEQGNPDRPYVTGSLFYKANSEGAATDNTVKSMRTRSGHTLEFKDDEGGDWGITLRDI
NGNVIHLNSKDKNIDITAPETITLTAKNVCINTEENVQITAKKNIDMTVEADINSSAKGNLLLQADKDVL
TAAKGNVGIEAKSDINMVGKNIAVEGNSKITLNGGQTQVAGQQTTIQGAANKIEIM
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2359520-2357670 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGGCATCGACAAACTTGGACGCTGTAAGCGTGGAGATAAAAGTAGCAGGAAAAGTCTGCGATTATGTGA
CAATGGAACTTTTTCAGTCGGTCAGTACACATCACCGTTTCAAAATCAAAGTGAACTACCGTCCGGACAA
ACCAAGCGTGTGGGCTATCGGTCCCGATGTGATATTCAAGCAACTGGGTGAGAAGGTATCCATCATCATG
ACCCACCATGAGAGTGGAGAAAAAACGGAATTTCACGGACTGATTTCTGATATTCATGTTGAAGGTTTCG
ACGGTAATCAGGGATTTGTCATACTGGAAGGGGGAAGCCCTACCATCCTGCTGGACAGAGACCCCGCTAT
GGACTGCTATGTAGAGCAAAACCTGAATACGATAGTCAGCGACATACTTGATAAGAGCGGGGTGAAAATG
AATGTGACCAACAATCCCAAACATACGGACATCATCCCTTATGTTGCCCGCTATAAAGAGACAAGCTACG
GATTCCTATCCCGTCTGCTCCGCTCTTATGGCGAGTGGTTCTATTACAACGGGGAAACGCTACAGATAGG
AGACCCAGAAATAGATACGGAAAGCCGTGCAGGGTATGATGTAGACCTGACGGGAGTCAGCATCAATGCC
ACTATCCGTTCTCTGAATCACAGCACCTATGAGTTCGACCCCGTCAATGATAAGTTCTATTACGACTACA
GTGGAACACCTAAGGGTGCTACTCTTGGTTCCCGTTCGGCTGAGAAATGCAGTGAACCTATCTTCCCTAC
CGAGGCAAAACTACCCTCGATAAGACCTGCGTATAGCGCAATGGATTTGGAACACTACGGGGATGCCGGA
TTTCACCGCAACTATTCCCAATTGTCTCAAATCAAGGCTTCAAGCCGTTACTGCGGCATACGACTGGGAG
AATTGGTGGTTACCCGTGTACCCGAAAGTTTCCCAGGAGTTAAGATTACCGATTTGGGACGTTACCGCAT
CACGGAGATTACCCATACGGTAAACTATAAAGGACAATATAGCAACACCTTCTGTGGCGTACCGGGTGGT
ACGCCCATCATGCCGTGGGGAGATGCCGTGATGCCGGTAGCCTATCCGGAAATGGCGAGAGTAGTGAGCA
ATGACGACCCTAAAAATCAGGGACGTGTCAAAGTACAGTTCATGTGGCAGGAGGTAGATGGCGGTGAGAG
CTACTGGATGCGAGTGCAAAGCCCCGATGCAGGCAAGAGCGAGCAAGTTGCCAAAAACCGTGGTTTTGTG
TTTATCCCCGAGCCGGGTGATTTGGTGATGGTAGGCTTCGAACAAGGCAATCCAGACCGTCCTTATGTGA
CAGGCAGCCTTTTCTATAAGGCTAATTCAGAGGGAGCGGCAACGGATAATACTGTTAAGAGTATGCGGAC
ACGCAGCGGGCATACGCTGGAGTTCAAGGATGATGAGGGTGGAGACTGGGGTATTACCCTTCGAGACATT
AACGGAAATGTTATACATCTGAATAGTAAAGACAAGAATATTGATATTACTGCCCCAGAAACCATCACAT
TGACAGCAAAAAATGTTTGCATCAATACTGAAGAGAATGTGCAGATTACAGCTAAAAAGAACATTGATAT
GACGGTTGAAGCGGATATTAACAGCTCAGCTAAAGGCAATCTACTATTGCAGGCTGACAAAGATGTATTG
ACTGCTGCAAAAGGAAATGTCGGCATCGAGGCAAAATCAGATATCAACATGGTTGGAAAGAATATTGCAG
TGGAGGGTAATTCCAAGATTACACTAAACGGGGGACAGACACAAGTCGCCGGACAACAGACGACAATACA
AGGAGCTGCCAATAAAATAGAGATTATGTAA