SecReT6
Protein ID: 60681502
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2014
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2359546..2361363 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ5LDU3
KEGG IDbfs:BF2014
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 605 a.a.     [Download]
>gi|60681502|ref|YP_211646.1| hypothetical protein BF2014 [Bacteroides fragilis NCTC 9343]
MANLFTKESIKARMFKQAATLYDIRNIDGMDPLIRLLIEALSGEIFKLSGDMHAIESRLLEKVASALTPH
TALVAKPAHAIAAARPYTPQATVSPTDLFSYKSTEIVKKYKMKNLFFTPLHETRIINAELKYLVTADEFC
TITPEGERDATARFRSDVPVMGRKISIGMKIGNNVTTLNDLPLYIDIPLVADKSSYLKLLPYCHCTIAGI
PVEIKGGIEYDPTRSVSEKYDLGRLITEEITSKYASHYLTLKAHGLKVRDLSRSRVPEEISFLLPSDFIA
ECDADTVWIDIEFPTAFSKEILEQVKVQMNTFIVVNKYPAKITRKVDSVSAILPLEKTEFEYFLFVDSIT
DNHGDRLREISGTQDEGRAGCYSVRRGGCERFNAMDAKDFLNRLTDLLYDESMAFSSTDKDGMKEVIEQI
EERVNQLGDKNKDGVGGQEMLSYVVIDQRYDKDTRLTVDYTLTNGEFANDIYAGEPLNDCANSDIDGDTL
RFVTSARGGKPSPSVKRRMDMYRFMLLSHGRIYTKEDIRNFCMARYGDSIRSVEVKLGYVAGKKESEGFI
RTLDVYLRLSEGMQGLDREEFVVNLDSELRRLSPETYNYRVFINS
 
Nucleotide Sequence: 1818 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2361363-2359546 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGGCAAATCTATTCACAAAAGAAAGCATTAAAGCCCGGATGTTCAAACAGGCGGCAACCCTATATGACA
TACGAAATATAGATGGCATGGACCCCCTTATCCGACTGCTGATTGAAGCCTTGTCGGGCGAAATTTTCAA
GCTGTCCGGTGATATGCACGCCATTGAAAGCCGATTGTTGGAGAAAGTCGCTTCCGCCCTTACTCCACAC
ACGGCATTGGTTGCCAAACCCGCCCATGCTATTGCTGCTGCCCGACCATATACACCGCAAGCTACTGTAT
CTCCCACAGACCTGTTTTCTTATAAAAGCACGGAGATAGTGAAGAAGTATAAGATGAAAAATCTCTTCTT
TACTCCGCTGCATGAAACCCGCATAATCAATGCCGAACTGAAGTATCTCGTGACGGCGGATGAATTTTGC
ACCATCACTCCCGAAGGAGAACGTGACGCCACTGCCCGCTTTCGTTCCGATGTGCCGGTAATGGGTCGGA
AAATCAGTATCGGGATGAAAATAGGCAACAATGTAACTACTCTCAACGACTTGCCGTTATATATAGATAT
ACCGCTTGTAGCAGATAAAAGCAGTTATCTGAAATTACTGCCGTACTGCCATTGCACGATTGCCGGTATT
CCTGTAGAAATTAAAGGGGGAATCGAGTACGACCCCACACGTTCGGTCAGTGAGAAATACGATCTTGGCA
GGTTGATTACGGAAGAAATAACCAGCAAATATGCTTCCCATTACCTGACATTGAAAGCTCACGGATTAAA
AGTCAGAGATTTGTCACGTAGCAGAGTGCCCGAAGAAATCTCTTTCCTGCTGCCAAGTGATTTCATTGCC
GAATGTGATGCGGATACTGTTTGGATAGATATAGAATTTCCCACCGCTTTTTCAAAAGAAATACTGGAAC
AGGTAAAGGTGCAGATGAACACTTTTATCGTAGTAAACAAATATCCGGCAAAGATTACCAGAAAGGTAGA
TTCCGTCTCGGCCATTCTCCCTTTGGAAAAGACGGAATTTGAATATTTCCTGTTTGTGGATTCGATTACC
GATAACCACGGAGACCGGCTTAGGGAAATTTCCGGCACACAGGATGAAGGCAGAGCCGGCTGTTATTCGG
TCAGAAGGGGCGGTTGCGAACGCTTCAATGCGATGGATGCCAAAGATTTTCTGAACCGCCTGACAGACCT
GCTATATGACGAAAGCATGGCCTTCTCTTCGACAGACAAAGACGGGATGAAAGAGGTGATCGAGCAGATA
GAGGAACGGGTAAACCAATTGGGAGATAAAAATAAAGACGGAGTCGGAGGACAGGAAATGTTGTCATATG
TAGTCATTGACCAACGTTATGACAAGGATACCCGGTTAACTGTGGATTATACTCTTACTAATGGCGAATT
TGCCAATGACATCTATGCGGGAGAGCCATTAAATGACTGCGCCAACTCCGATATAGACGGAGATACACTG
CGGTTTGTCACTTCTGCCCGTGGAGGAAAGCCGTCCCCATCCGTAAAGCGCCGGATGGATATGTACCGAT
TCATGCTATTGTCACACGGCAGGATATACACGAAAGAGGATATACGCAACTTCTGCATGGCAAGGTATGG
CGACAGCATTCGCTCTGTGGAGGTAAAGCTGGGGTATGTAGCCGGTAAAAAAGAAAGCGAAGGTTTCATA
AGGACGCTGGACGTGTATCTACGGTTATCGGAGGGGATGCAAGGATTGGACAGGGAAGAGTTCGTTGTCA
ATTTGGACAGTGAGCTCAGGCGGTTGTCTCCGGAGACCTATAACTACCGTGTTTTTATTAACTCATAG