SecReT6
Protein ID: 60681503
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2015
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2361394..2361834 [-]
Productbacteriophage Gp25 protein
NoteTssE
UniProt IDQ5LDU2
KEGG IDbfs:BF2015
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-18, Aligned region: 24..128
Protein Sequence: 146 a.a.     [Download]
>gi|60681503|ref|YP_211647.1| bacteriophage Gp25 protein [Bacteroides fragilis NCTC 9343]
MKQKYYKLPVRLEKLFEGDIRQLERCSELESIDQHIELLLTTCPGEHRFDPKYGCRIWELDFERIVSTEQ
WKELFTGYVMQAISTYEKRISDITLSVNLQEVVREEVLDNRMIRKRVDITVLATLNSTGAPCGFGYKLYM
GPLSNE
 
Nucleotide Sequence: 441 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2361834-2361394 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGAAACAGAAATACTATAAACTACCGGTACGTTTGGAAAAGCTCTTCGAAGGAGATATCCGGCAACTGG
AAAGATGTTCCGAACTGGAATCCATCGACCAGCACATCGAACTGTTGCTGACCACCTGTCCGGGTGAGCA
CCGTTTCGACCCCAAATACGGTTGTCGGATTTGGGAGTTGGACTTTGAGCGCATTGTTTCTACCGAACAA
TGGAAAGAACTGTTTACCGGATACGTGATGCAGGCGATTTCCACTTATGAGAAACGCATTTCCGACATCA
CTCTCTCGGTAAACCTACAAGAAGTCGTCAGGGAAGAAGTTCTGGATAACCGGATGATACGTAAGCGGGT
AGATATTACAGTACTCGCCACATTGAATTCCACCGGTGCTCCCTGCGGTTTCGGTTACAAATTATACATG
GGACCTTTATCAAACGAATAA