SecReT6
Protein ID: 60681505
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2017
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2362294..2362713 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ5LDU0
KEGG IDbfs:BF2017
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 139 a.a.     [Download]
>gi|60681505|ref|YP_211649.1| hypothetical protein BF2017 [Bacteroides fragilis NCTC 9343]
MGFFDRLFKGKEVFADRRNPDMVCEITLCGQSHILSEFDIAYEPDNSSKEYMEAYAVFSEPVNAEVENWI
MRADRKENGTVRFYLNSDAMDEGALFEINFSNASCVHYHNVSQGDTSVKTIVMTFPSVRMGGDEFELKR
 
Nucleotide Sequence: 420 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2362713-2362294 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGGGCTTTTTCGACAGGCTGTTTAAAGGAAAAGAAGTGTTTGCGGATAGACGCAATCCGGATATGGTAT
GCGAGATAACGCTTTGCGGGCAGTCGCACATCTTGTCCGAGTTTGATATTGCCTATGAGCCGGATAATTC
CTCGAAAGAATATATGGAAGCATACGCCGTATTTTCAGAGCCGGTGAATGCGGAGGTAGAAAACTGGATA
ATGAGAGCGGACAGGAAAGAAAACGGGACAGTCCGATTCTATCTCAACAGCGATGCTATGGACGAAGGTG
CACTGTTCGAGATAAATTTCAGTAATGCGAGCTGCGTGCATTATCACAATGTATCGCAGGGAGACACATC
GGTAAAGACCATTGTGATGACTTTTCCGTCTGTCCGGATGGGAGGTGATGAATTTGAACTAAAACGATAA