SecReT6
Protein ID: 60681505
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2017
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2362294..2362713 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ5LDU0
KEGG IDbfs:BF2017
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 139 a.a.     [Download]
>gi|60681505|ref|YP_211649.1| hypothetical protein BF2017 [Bacteroides fragilis NCTC 9343]
MGFFDRLFKGKEVFADRRNPDMVCEITLCGQSHILSEFDIAYEPDNSSKEYMEAYAVFSEPVNAEVENWI
MRADRKENGTVRFYLNSDAMDEGALFEINFSNASCVHYHNVSQGDTSVKTIVMTFPSVRMGGDEFELKR
 
Nucleotide Sequence: 420 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2362713-2362294 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGGGCTTTTTCGACAGGCTGTTTAAAGGAAAAGAAGTGTTTGCGGATAGACGCAATCCGGATATGGTAT
GCGAGATAACGCTTTGCGGGCAGTCGCACATCTTGTCCGAGTTTGATATTGCCTATGAGCCGGATAATTC
CTCGAAAGAATATATGGAAGCATACGCCGTATTTTCAGAGCCGGTGAATGCGGAGGTAGAAAACTGGATA
ATGAGAGCGGACAGGAAAGAAAACGGGACAGTCCGATTCTATCTCAACAGCGATGCTATGGACGAAGGTG
CACTGTTCGAGATAAATTTCAGTAATGCGAGCTGCGTGCATTATCACAATGTATCGCAGGGAGACACATC
GGTAAAGACCATTGTGATGACTTTTCCGTCTGTCCGGATGGGAGGTGATGAATTTGAACTAAAACGATAA

Protein ID: 60681506
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2018
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2362716..2363123 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ5LDT9
KEGG IDbfs:BF2018
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 135 a.a.     [Download]
>gi|60681506|ref|YP_211650.1| hypothetical protein BF2018 [Bacteroides fragilis NCTC 9343]
MQTYLYLHKENIDLPHGVYRGKYPLKHFDYGLSRNVGRKGEITSGVCGGEIRIVIDGFADATLLGWLFDT
FRKEDGAIVTLDEHETTFAKLQFSGASVRSYRMNYDSRVKKGVVTIIVIEAKEIVTDNDLFFKNK
 
Nucleotide Sequence: 408 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2363123-2362716 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGCAAACCTATTTATACTTACATAAAGAGAATATCGACCTTCCTCACGGTGTGTATCGGGGGAAATATC
CGCTGAAACACTTTGATTACGGATTGAGCCGTAATGTGGGGCGTAAAGGTGAAATCACTTCCGGCGTATG
CGGCGGAGAAATACGAATCGTCATTGATGGATTTGCTGACGCTACCCTGCTGGGATGGCTCTTTGACACC
TTCCGTAAAGAAGATGGAGCGATTGTTACACTGGATGAACACGAAACGACCTTTGCCAAACTGCAATTTT
CGGGCGCATCGGTAAGGAGCTATCGTATGAACTACGATTCGCGGGTTAAAAAAGGTGTGGTGACTATCAT
TGTGATAGAAGCCAAAGAGATTGTAACGGACAATGACTTATTTTTTAAAAACAAATAA

Protein ID: 60681509
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2021
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2364997..2365404 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ5LDT6
KEGG IDbfs:BF2021
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 135 a.a.     [Download]
>gi|60681509|ref|YP_211653.1| hypothetical protein BF2021 [Bacteroides fragilis NCTC 9343]
MELFSFLQVDSDLTAWFILDGQEYEMSHFDINFAQSVDHKGQPQDEVRGGIMSITLSQTLPENIYRWGMT
SIPKNGSVIFKSKTTNPPLKINFINAYCIRFNRSIANEGGLESQLVISPDEMLINGISFDNHWVK
 
Nucleotide Sequence: 408 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2365404-2364997 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGGAATTATTTAGTTTTCTACAAGTAGACAGCGACTTAACAGCATGGTTTATCCTTGATGGTCAGGAAT
ATGAGATGAGCCATTTCGATATAAATTTCGCGCAATCTGTCGACCATAAAGGGCAACCGCAAGATGAAGT
ACGTGGTGGTATCATGTCCATTACATTATCACAAACGCTTCCTGAAAACATTTACAGATGGGGAATGACG
TCCATTCCCAAAAACGGGTCTGTGATTTTTAAATCAAAGACAACAAATCCTCCCTTGAAAATTAATTTCA
TCAACGCATATTGCATACGATTTAATCGAAGTATAGCCAACGAAGGAGGATTAGAAAGTCAACTGGTAAT
ATCTCCTGATGAGATGTTAATAAATGGAATTAGCTTTGACAATCACTGGGTTAAATAA

Protein ID: 60681510
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2022
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2365431..2365859 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ5LDT5
KEGG IDbfs:BF2022
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|60681510|ref|YP_211654.1| hypothetical protein BF2022 [Bacteroides fragilis NCTC 9343]
MFGHKSFLRIGALGDSSISGLYKDSYELENCHFSFNQGTNTDGKPQTDVRGGTLYLTYAGLPQDDMLRWI
LNSKKYEDGAIVICDDSDEPLEKILFEQAACTGLNIEYTQKGKAYIHTKIILQVRKIKVGETTFENRWTI
NE
 
Nucleotide Sequence: 429 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2365859-2365431 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGTTTGGACATAAAAGTTTTTTGAGGATAGGTGCTTTGGGCGATTCCAGTATTTCGGGATTGTACAAAG
ACAGTTATGAACTTGAAAATTGCCATTTCAGTTTTAATCAGGGAACGAACACGGATGGCAAACCGCAAAC
TGATGTACGGGGTGGAACCTTGTACCTGACTTATGCCGGTTTACCGCAAGATGATATGCTCCGCTGGATA
CTGAACTCTAAAAAATATGAAGACGGTGCAATTGTAATATGCGATGACAGTGATGAACCTTTGGAAAAGA
TTTTATTTGAGCAGGCAGCCTGTACTGGATTGAATATTGAATATACGCAAAAAGGAAAAGCCTATATACA
TACTAAAATTATTCTCCAAGTACGAAAAATAAAGGTAGGTGAGACAACGTTTGAAAATCGTTGGACTATT
AACGAATAA

Protein ID: 60681514
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2026
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2370304..2370693 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ5LDT1
KEGG IDbfs:BF2026
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 129 a.a.     [Download]
>gi|60681514|ref|YP_211658.1| hypothetical protein BF2026 [Bacteroides fragilis NCTC 9343]
MAFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILENMTNQFKPHSGSIV
FKKGDEEAKMKELTWENGYITEFTENIDIVGSQPMTITFVVSAQVIKIGGAQFEQNWPK
 
Nucleotide Sequence: 390 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2370693-2370304 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGGCATTTAGAGCAACCTTAAGCTTTGCAGGAAAAGAGTTTGACGTGCTGGATTGCACGTACAGTCTCA
AGCGAGATGTGGATTCCAAAGGACGCCCATCTTCAAACATTTATGGTGGACAAATTCGTCTGCATGTGGA
ATCGACTGATGATACTTCCATTCTGGAGAACATGACCAATCAGTTTAAACCTCATTCCGGCAGCATCGTC
TTCAAAAAAGGAGATGAAGAAGCCAAGATGAAGGAACTTACCTGGGAAAACGGATACATTACCGAATTTA
CCGAAAACATCGACATTGTCGGCTCGCAGCCGATGACTATCACTTTTGTCGTATCGGCTCAGGTAATCAA
GATTGGTGGCGCACAATTTGAACAGAATTGGCCGAAGTAA