SecReT6
Protein ID: 60681506
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2018
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2362716..2363123 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ5LDT9
KEGG IDbfs:BF2018
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 135 a.a.     [Download]
>gi|60681506|ref|YP_211650.1| hypothetical protein BF2018 [Bacteroides fragilis NCTC 9343]
MQTYLYLHKENIDLPHGVYRGKYPLKHFDYGLSRNVGRKGEITSGVCGGEIRIVIDGFADATLLGWLFDT
FRKEDGAIVTLDEHETTFAKLQFSGASVRSYRMNYDSRVKKGVVTIIVIEAKEIVTDNDLFFKNK
 
Nucleotide Sequence: 408 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2363123-2362716 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGCAAACCTATTTATACTTACATAAAGAGAATATCGACCTTCCTCACGGTGTGTATCGGGGGAAATATC
CGCTGAAACACTTTGATTACGGATTGAGCCGTAATGTGGGGCGTAAAGGTGAAATCACTTCCGGCGTATG
CGGCGGAGAAATACGAATCGTCATTGATGGATTTGCTGACGCTACCCTGCTGGGATGGCTCTTTGACACC
TTCCGTAAAGAAGATGGAGCGATTGTTACACTGGATGAACACGAAACGACCTTTGCCAAACTGCAATTTT
CGGGCGCATCGGTAAGGAGCTATCGTATGAACTACGATTCGCGGGTTAAAAAAGGTGTGGTGACTATCAT
TGTGATAGAAGCCAAAGAGATTGTAACGGACAATGACTTATTTTTTAAAAACAAATAA