SecReT6
Protein ID: 60681510
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2022
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2365431..2365859 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ5LDT5
KEGG IDbfs:BF2022
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|60681510|ref|YP_211654.1| hypothetical protein BF2022 [Bacteroides fragilis NCTC 9343]
MFGHKSFLRIGALGDSSISGLYKDSYELENCHFSFNQGTNTDGKPQTDVRGGTLYLTYAGLPQDDMLRWI
LNSKKYEDGAIVICDDSDEPLEKILFEQAACTGLNIEYTQKGKAYIHTKIILQVRKIKVGETTFENRWTI
NE
 
Nucleotide Sequence: 429 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2365859-2365431 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGTTTGGACATAAAAGTTTTTTGAGGATAGGTGCTTTGGGCGATTCCAGTATTTCGGGATTGTACAAAG
ACAGTTATGAACTTGAAAATTGCCATTTCAGTTTTAATCAGGGAACGAACACGGATGGCAAACCGCAAAC
TGATGTACGGGGTGGAACCTTGTACCTGACTTATGCCGGTTTACCGCAAGATGATATGCTCCGCTGGATA
CTGAACTCTAAAAAATATGAAGACGGTGCAATTGTAATATGCGATGACAGTGATGAACCTTTGGAAAAGA
TTTTATTTGAGCAGGCAGCCTGTACTGGATTGAATATTGAATATACGCAAAAAGGAAAAGCCTATATACA
TACTAAAATTATTCTCCAAGTACGAAAAATAAAGGTAGGTGAGACAACGTTTGAAAATCGTTGGACTATT
AACGAATAA