SecReT6
Protein ID: 60681511
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2023
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2365875..2368358 [-]
ProductATP-dependent protease
NoteClpV
UniProt IDQ5LDT4
KEGG IDbfs:BF2023
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.60E-45, Aligned region: 211..290
AAA_2 [PF07724], Evalue: 3.60E-45, Aligned region: 566..728
AAA [PF00004], Evalue: 7.80E-21, Aligned region: 212..342
AAA [PF00004], Evalue: 7.80E-21, Aligned region: 571..688
ClpB_D2-small [PF10431], Evalue: 6.80E-18, Aligned region: 735..814
AAA_5 [PF07728], Evalue: 9.00E-17, Aligned region: 211..291
AAA_5 [PF07728], Evalue: 9.00E-17, Aligned region: 570..691
AAA_16 [PF13191], Evalue: 1.50E-15, Aligned region: 190..230
AAA_16 [PF13191], Evalue: 1.50E-15, Aligned region: 257..292
AAA_16 [PF13191], Evalue: 1.50E-15, Aligned region: 538..606
AAA_22 [PF13401], Evalue: 5.20E-09, Aligned region: 210..305
AAA_22 [PF13401], Evalue: 5.20E-09, Aligned region: 568..595
Sigma54_activat [PF00158], Evalue: 8.00E-09, Aligned region: 210..229
Sigma54_activat [PF00158], Evalue: 8.00E-09, Aligned region: 569..681
AAA_14 [PF13173], Evalue: 1.40E-07, Aligned region: 210..313
AAA_14 [PF13173], Evalue: 1.40E-07, Aligned region: 571..666
NACHT [PF05729], Evalue: 2.10E-07, Aligned region: 212..240
NACHT [PF05729], Evalue: 2.10E-07, Aligned region: 571..654
IstB_IS21 [PF01695], Evalue: 9.20E-07, Aligned region: 210..235
IstB_IS21 [PF01695], Evalue: 9.20E-07, Aligned region: 570..598
AAA_18 [PF13238], Evalue: 2.20E-06, Aligned region: 212..289
AAA_18 [PF13238], Evalue: 2.20E-06, Aligned region: 572..600
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 208..232
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 570..594
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 797..816
AAA_29 [PF13555], Evalue: 2.10E-05, Aligned region: 209..230
AAA_29 [PF13555], Evalue: 2.10E-05, Aligned region: 569..596
AAA_17 [PF13207], Evalue: 2.80E-05, Aligned region: 212..252
AAA_17 [PF13207], Evalue: 2.80E-05, Aligned region: 573..605
Zeta_toxin [PF06414], Evalue: 5.10E-05, Aligned region: 212..226
Zeta_toxin [PF06414], Evalue: 5.10E-05, Aligned region: 299..338
Zeta_toxin [PF06414], Evalue: 5.10E-05, Aligned region: 569..624
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 212..237
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 569..594
AAA_23 [PF13476], Evalue: 0.00013, Aligned region: 209..241
AAA_23 [PF13476], Evalue: 0.00013, Aligned region: 570..607
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 193..226
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 266..296
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 570..599
PhoH [PF02562], Evalue: 0.00025, Aligned region: 195..232
PhoH [PF02562], Evalue: 0.00025, Aligned region: 570..596
Mg_chelatase [PF01078], Evalue: 0.00029, Aligned region: 196..231
Mg_chelatase [PF01078], Evalue: 0.00029, Aligned region: 570..593
RNA_helicase [PF00910], Evalue: 0.00035, Aligned region: 212..235
RNA_helicase [PF00910], Evalue: 0.00035, Aligned region: 571..594
UPF0079 [PF02367], Evalue: 0.00044, Aligned region: 212..233
UPF0079 [PF02367], Evalue: 0.00044, Aligned region: 571..594
UPF0079 [PF02367], Evalue: 0.00044, Aligned region: 801..814
AAA_24 [PF13479], Evalue: 0.00046, Aligned region: 211..227
AAA_24 [PF13479], Evalue: 0.00046, Aligned region: 469..494
AAA_24 [PF13479], Evalue: 0.00046, Aligned region: 571..592
MobB [PF03205], Evalue: 0.00066, Aligned region: 211..247
MobB [PF03205], Evalue: 0.00066, Aligned region: 573..597
ABC_tran [PF00005], Evalue: 0.00075, Aligned region: 212..237
ABC_tran [PF00005], Evalue: 0.00075, Aligned region: 571..608
T2SE [PF00437], Evalue: 0.00086, Aligned region: 197..227
T2SE [PF00437], Evalue: 0.00086, Aligned region: 567..619
T2SE [PF00437], Evalue: 0.00086, Aligned region: 786..814
AAA_28 [PF13521], Evalue: 0.0011, Aligned region: 212..252
AAA_28 [PF13521], Evalue: 0.0011, Aligned region: 571..590
Miro [PF08477], Evalue: 0.0011, Aligned region: 212..232
Miro [PF08477], Evalue: 0.0011, Aligned region: 570..593
FtsK_SpoIIIE [PF01580], Evalue: 0.0022, Aligned region: 208..240
FtsK_SpoIIIE [PF01580], Evalue: 0.0022, Aligned region: 573..593
DUF87 [PF01935], Evalue: 0.0028, Aligned region: 212..235
DUF87 [PF01935], Evalue: 0.0028, Aligned region: 572..603
RuvB_N [PF05496], Evalue: 0.0034, Aligned region: 267..292
RuvB_N [PF05496], Evalue: 0.0034, Aligned region: 539..591
RuvB_N [PF05496], Evalue: 0.0034, Aligned region: 639..671
AAA_10 [PF12846], Evalue: 0.0038, Aligned region: 210..230
AAA_10 [PF12846], Evalue: 0.0038, Aligned region: 278..298
AAA_10 [PF12846], Evalue: 0.0038, Aligned region: 394..441
AAA_10 [PF12846], Evalue: 0.0038, Aligned region: 569..593
AAA_30 [PF13604], Evalue: 0.0043, Aligned region: 210..230
AAA_30 [PF13604], Evalue: 0.0043, Aligned region: 408..434
AAA_30 [PF13604], Evalue: 0.0043, Aligned region: 572..596
PduV-EutP [PF10662], Evalue: 0.0051, Aligned region: 211..232
PduV-EutP [PF10662], Evalue: 0.0051, Aligned region: 571..593
DUF258 [PF03193], Evalue: 0.0052, Aligned region: 189..231
DUF258 [PF03193], Evalue: 0.0052, Aligned region: 571..590
Bac_DnaA [PF00308], Evalue: 0.0055, Aligned region: 212..362
Bac_DnaA [PF00308], Evalue: 0.0055, Aligned region: 562..596
ResIII [PF04851], Evalue: 0.0059, Aligned region: 208..228
ResIII [PF04851], Evalue: 0.0059, Aligned region: 265..309
ResIII [PF04851], Evalue: 0.0059, Aligned region: 572..593
TIP49 [PF06068], Evalue: 0.0082, Aligned region: 205..250
TIP49 [PF06068], Evalue: 0.0082, Aligned region: 281..292
TIP49 [PF06068], Evalue: 0.0082, Aligned region: 570..594
TIP49 [PF06068], Evalue: 0.0082, Aligned region: 772..811
Protein Sequence: 827 a.a.     [Download]
>gi|60681511|ref|YP_211655.1| ATP-dependent protease [Bacteroides fragilis NCTC 9343]
MDFLNINETVQSVIRISKGVAREYGNASYAPAHLLFALMHKEVGLRSFVESLGKDADYLREWAEVRIEEY
PKAAGAGEIMPDGKVNELFEQADNVRIKWGLLEINPLCLLAAIATPEAGFSTDELRSFPIREREIHDLFT
SGMGNMKKSVSTQTDLPGSEAPLWTAGAGNLDKYCTDKTALAADKKVYPIVCRDRETRMMMEILGRMGKP
NVLIIGDAGVGKTALVDGLACSIIEGTVPQYLKDMTIYELDTGTLIAGATYKGEIEERLKGIIKELSAHG
NAILFIDEIHTLIDPKSGNSGAASILKPELAKGNITVIGVTTVDEYRKLIEPDHALNRRFEVLQVSEPDL
ASTVNMIQAALERYESYHGVGVDVDSLPECVALAKRYVKERRLPDAAIDLIDRTLSAVKMINQSGEKDIK
GLAEQLAAIEAAEDQPEAERTEKLRLVNFTMKNRLSPILLGMLSDGQNEPESSDYGEWMDYILGVLDRLR
ELTKEKIGKITSHEVAAVISSSTGIPIGKIESGEKEKLLNMEDILRRRVVGQDNALKVLTDAIVESRSGM
NKPGQPIGSFFLLGPTGTGKTELAKALAEALFNDEKAMIRFDMSEFKEEHSAALLLGAPPGYVGYEEGGV
LVNRIRRQPYAVVLFDEIEKAHSSVYDIFLQIMDEGKLHDRLGKEGDFSNSIVLFTSNVGSEWLSKQINE
GKNPSTTDLMEVMGSYFRPEFLARLSEIVPFSPINETMLVRIFEIQLKGVIALLEKQHIDIEITEKAKNL
LATRGFTPKYGARQVAGTIRNYIRRPISKMIVAGTLAAGNTVVVDVADNGDIDWNVK
 
Nucleotide Sequence: 2484 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2368358-2365875 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGGATTTTTTGAACATCAATGAAACAGTTCAGAGCGTAATCCGAATATCAAAAGGTGTCGCCCGTGAGT
ATGGCAATGCCAGCTATGCTCCGGCACACCTTTTGTTTGCCTTGATGCACAAAGAGGTAGGTCTGCGTTC
GTTTGTCGAATCGTTGGGTAAGGATGCCGATTACTTGCGCGAATGGGCGGAGGTAAGAATAGAGGAGTAC
CCCAAGGCTGCCGGTGCAGGCGAGATAATGCCCGATGGGAAAGTTAACGAACTGTTTGAGCAAGCCGATA
ATGTACGAATCAAGTGGGGACTGCTGGAAATCAATCCACTTTGCCTGCTGGCAGCCATTGCTACACCCGA
AGCAGGTTTCAGTACGGACGAGTTGCGCTCGTTCCCTATTCGGGAGCGTGAGATACATGACCTCTTCACG
AGCGGAATGGGTAATATGAAAAAATCCGTAAGTACGCAGACTGACCTTCCGGGGAGTGAAGCCCCCCTAT
GGACAGCCGGGGCGGGCAATTTAGATAAGTACTGTACGGATAAGACTGCTCTTGCGGCAGACAAGAAAGT
ATATCCTATCGTGTGCCGTGACCGTGAGACACGCATGATGATGGAAATTCTGGGGCGGATGGGTAAGCCC
AACGTGCTCATCATCGGCGATGCCGGTGTGGGTAAGACTGCTCTGGTAGATGGTTTGGCATGCAGCATCA
TTGAGGGTACAGTTCCCCAATATCTAAAGGACATGACTATCTATGAGCTTGACACAGGAACACTGATTGC
GGGTGCTACCTACAAAGGCGAGATAGAAGAACGGCTGAAAGGAATCATCAAAGAATTGTCGGCTCACGGC
AATGCGATTCTCTTCATTGATGAAATACATACGCTGATCGACCCCAAGTCGGGCAACAGCGGAGCGGCAA
GCATCCTGAAACCGGAGCTTGCCAAAGGAAATATAACGGTAATCGGAGTCACTACGGTGGACGAATACCG
TAAACTGATTGAACCGGACCATGCCCTTAACCGGCGTTTTGAAGTATTGCAAGTATCGGAACCTGACCTT
GCATCCACCGTAAATATGATACAGGCAGCTTTGGAAAGATATGAAAGCTACCACGGTGTGGGGGTAGATG
TAGATTCGTTGCCGGAATGCGTGGCACTCGCCAAGCGTTATGTCAAGGAACGCCGTTTGCCGGATGCCGC
TATTGATTTGATAGACCGTACCCTCTCTGCGGTTAAGATGATTAACCAGAGCGGGGAAAAAGATATAAAG
GGACTGGCAGAGCAGCTTGCCGCGATTGAAGCGGCGGAAGACCAGCCCGAAGCGGAGCGCACGGAGAAGT
TGCGGTTAGTCAACTTCACCATGAAGAACCGGTTAAGCCCTATCCTTCTGGGAATGCTCTCCGATGGACA
GAATGAACCGGAGTCATCAGACTACGGTGAATGGATGGATTATATTTTAGGTGTACTTGACCGATTGCGT
GAATTGACCAAAGAGAAAATCGGGAAAATCACTTCCCATGAAGTGGCAGCCGTTATTTCTTCTTCTACAG
GTATCCCTATCGGCAAGATAGAGTCGGGCGAGAAAGAGAAGTTGCTCAATATGGAAGATATTCTGCGTCG
TAGAGTTGTTGGACAGGACAATGCGCTGAAGGTATTGACAGATGCCATTGTCGAATCACGAAGTGGAATG
AACAAACCGGGACAACCGATTGGCTCATTCTTCCTGCTGGGACCTACCGGAACCGGTAAGACCGAGTTGG
CAAAAGCATTGGCAGAAGCACTTTTCAATGACGAAAAGGCGATGATTCGTTTTGATATGTCAGAGTTTAA
GGAAGAACATTCGGCAGCCCTGCTATTGGGAGCGCCTCCGGGATACGTGGGCTACGAAGAAGGTGGCGTA
CTCGTGAACCGGATACGTCGTCAGCCTTACGCGGTGGTGCTTTTCGATGAGATAGAGAAAGCCCATTCTT
CCGTTTATGACATCTTCCTGCAAATCATGGACGAAGGCAAGCTACACGACCGTTTGGGCAAAGAGGGTGA
TTTTTCCAATTCTATCGTACTGTTTACATCCAATGTAGGTAGCGAATGGCTTAGCAAACAGATTAATGAG
GGCAAGAATCCTTCTACCACTGACCTGATGGAAGTCATGGGCAGTTATTTCCGTCCGGAGTTTCTTGCCC
GTTTGTCGGAAATCGTGCCTTTCTCTCCTATTAACGAAACAATGCTGGTTCGTATCTTTGAGATACAGTT
AAAGGGAGTTATAGCATTGCTTGAGAAGCAGCATATTGACATTGAGATTACGGAGAAGGCAAAGAACCTG
CTTGCTACCCGTGGCTTCACTCCGAAATACGGAGCACGTCAGGTGGCGGGTACGATACGTAACTATATCC
GCCGTCCTATCTCAAAGATGATTGTTGCAGGAACATTGGCGGCAGGGAATACAGTTGTTGTCGATGTGGC
GGATAATGGAGATATTGATTGGAATGTGAAATGA