SecReT6
Protein ID: 60681512
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2024
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2368371..2369750 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ5LDT3
KEGG IDbfs:BF2024
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-35, Aligned region: 116..441
Phage_sheath_1 [PF04984], Evalue: 0.0016, Aligned region: 129..157
Phage_sheath_1 [PF04984], Evalue: 0.0016, Aligned region: 290..438
Protein Sequence: 459 a.a.     [Download]
>gi|60681512|ref|YP_211656.1| hypothetical protein BF2024 [Bacteroides fragilis NCTC 9343]
MEDNKNKSEVQAQETVQVSYKEKNRESSLASALDVLSRFGGFNFLESTVDGVQNLNPERKARKKIFLTDE
QKQEEREVLKNKIDMWIDLLNSSSAVTEMIATSKAKSEAAASHLAKSQLVAVQSVRDMEQAYRGVMLFYK
NTEADKVNNVTIVNASKEQLTDLDNPRFIDFVARELKQNYDKLDLRQNYSLLAIPGYLGSNKVLEKWAKI
AYENKVMLYTDFADLDKPEDVVELFSSSNMASGEAFKSNTCMTCNWLVGRAGYREIGEEEDLHVSPSIAL
MGKVYTTLMSQVTAGKKYGGINEIDAVVFPLKKSEISQLEKMGLIPMVNEYGKVMAFSAKTLFNGDNLGL
QTYSVVRVFDYITKVLFDFLNRRSFENWSSKTERDLRGQIVQYLDSVQGADRLIEKFKIIRFEQDQKQKD
RIYLDIHMTPFFPAKSFVIKLDGTKGDDGTNWNTNYEQA
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2369750-2368371 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGGAAGATAATAAAAATAAGTCTGAAGTTCAGGCGCAAGAAACCGTTCAAGTTTCCTATAAAGAGAAAA
ACAGGGAATCCTCTCTGGCTTCGGCACTGGATGTGTTGTCCAGATTCGGCGGTTTCAATTTTCTGGAATC
AACAGTAGATGGTGTTCAGAACCTGAACCCCGAGCGTAAGGCACGCAAAAAGATATTCTTAACCGATGAA
CAGAAGCAAGAAGAACGGGAAGTGCTGAAGAATAAGATAGATATGTGGATCGACCTGCTGAACTCATCAT
CGGCAGTGACGGAAATGATTGCCACTTCTAAAGCTAAATCGGAAGCTGCCGCATCGCATCTTGCCAAAAG
CCAATTGGTGGCAGTGCAGAGTGTGAGGGATATGGAACAGGCATACCGTGGAGTGATGTTGTTCTATAAG
AATACGGAAGCGGACAAAGTGAACAACGTGACGATAGTCAATGCTTCCAAAGAACAACTGACCGACCTCG
ACAATCCCCGCTTCATTGATTTCGTTGCCCGCGAACTGAAACAGAACTATGACAAGTTGGATTTACGTCA
AAATTACTCACTGTTAGCCATTCCGGGCTATCTTGGTTCGAATAAGGTACTTGAAAAATGGGCGAAAATC
GCTTATGAAAATAAAGTGATGCTCTATACGGACTTTGCCGACCTTGATAAGCCGGAAGATGTGGTGGAAC
TGTTCTCTTCCTCCAATATGGCAAGTGGGGAGGCCTTCAAAAGCAATACCTGCATGACCTGCAACTGGCT
GGTGGGACGTGCCGGATACCGGGAAATCGGTGAAGAGGAAGACCTCCATGTTTCTCCGTCCATTGCTTTG
ATGGGTAAAGTTTACACCACTCTGATGTCTCAGGTAACTGCCGGTAAGAAGTATGGCGGCATTAATGAAA
TAGATGCGGTGGTATTCCCGTTGAAGAAAAGCGAAATCTCACAACTGGAGAAAATGGGTTTAATTCCGAT
GGTCAATGAATATGGTAAAGTGATGGCGTTCTCCGCAAAGACATTGTTCAACGGTGACAATCTGGGATTG
CAAACTTATTCTGTGGTACGTGTATTCGACTATATTACCAAGGTATTGTTTGATTTCCTGAACCGCCGTT
CGTTCGAGAACTGGAGTTCTAAAACCGAACGTGACCTGAGAGGGCAGATTGTACAGTATCTTGATAGTGT
ACAGGGAGCCGACCGCCTTATCGAAAAATTCAAGATAATCCGTTTCGAGCAAGACCAAAAGCAGAAAGAC
CGTATTTATCTGGATATTCACATGACTCCGTTCTTCCCTGCCAAGAGCTTTGTTATCAAGTTGGACGGCA
CGAAAGGTGATGATGGTACAAACTGGAATACAAATTACGAACAGGCGTAA