SecReT6
Protein ID: 60681513
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2025
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2369766..2370215 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ5LDT2
KEGG IDbfs:BF2025
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 149 a.a.     [Download]
>gi|60681513|ref|YP_211657.1| hypothetical protein BF2025 [Bacteroides fragilis NCTC 9343]
MAILEYGIGGNEVKVDTSEAIANIPENRSLIVEQLTADEPVTPEAVKGLSTIEEVFAHFLPNIDVEFENE
EGQPVKENFRFSSVADFSVKNMTQNSPFLHKLDTEKTFYEGMVTQLRSNKVLQRVLENPESKKAFISALE
ALSNELKTE
 
Nucleotide Sequence: 450 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2370215-2369766 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGGCAATACTTGAATATGGAATTGGTGGTAATGAAGTGAAAGTTGATACTTCCGAAGCCATCGCAAACA
TTCCGGAGAATCGCTCCCTCATAGTTGAACAGTTAACTGCTGACGAACCTGTAACTCCTGAAGCGGTCAA
AGGCTTAAGCACTATCGAAGAGGTGTTTGCGCACTTCTTGCCCAACATTGATGTTGAATTTGAAAATGAA
GAAGGGCAACCGGTAAAAGAAAACTTTAGATTTAGCTCAGTGGCGGACTTCAGTGTGAAGAATATGACAC
AGAATAGTCCATTCCTCCATAAGTTGGATACGGAGAAAACATTCTACGAGGGGATGGTGACACAATTGCG
TTCTAATAAAGTTCTACAACGAGTGTTGGAGAATCCGGAATCCAAAAAGGCGTTTATCAGCGCGCTGGAA
GCATTGAGTAACGAATTAAAGACCGAATAA