SecReT6
Protein ID: 60681514
SecReT6 ID907
T6SS typeiii
Gene symbol-
Locus tagBF2026
StrainBacteroides fragilis NCTC 9343
Repliconchromosome [GenBank: NC_003228] [Browse all T6SS(s) in this replicon]
Location [Strand]2370304..2370693 [-]
Producthypothetical protein
NoteHcp
UniProt IDQ5LDT1
KEGG IDbfs:BF2026
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 129 a.a.     [Download]
>gi|60681514|ref|YP_211658.1| hypothetical protein BF2026 [Bacteroides fragilis NCTC 9343]
MAFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILENMTNQFKPHSGSIV
FKKGDEEAKMKELTWENGYITEFTENIDIVGSQPMTITFVVSAQVIKIGGAQFEQNWPK
 
Nucleotide Sequence: 390 bp     [Download]
>gi|60679597|ref|NC_003228.3|:c2370693-2370304 Bacteroides fragilis NCTC 9343 chromosome, complete genome
ATGGCATTTAGAGCAACCTTAAGCTTTGCAGGAAAAGAGTTTGACGTGCTGGATTGCACGTACAGTCTCA
AGCGAGATGTGGATTCCAAAGGACGCCCATCTTCAAACATTTATGGTGGACAAATTCGTCTGCATGTGGA
ATCGACTGATGATACTTCCATTCTGGAGAACATGACCAATCAGTTTAAACCTCATTCCGGCAGCATCGTC
TTCAAAAAAGGAGATGAAGAAGCCAAGATGAAGGAACTTACCTGGGAAAACGGATACATTACCGAATTTA
CCGAAAACATCGACATTGTCGGCTCGCAGCCGATGACTATCACTTTTGTCGTATCGGCTCAGGTAATCAA
GATTGGTGGCGCACAATTTGAACAGAATTGGCCGAAGTAA