SecReT6
Protein ID: 611963679
SecReT6 ID904
T6SS typei2
Gene symbolxmoA
Locus tagxmoA
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678349] [Browse all T6SS(s) in this replicon]
Location [Strand]01..501 [+]
ProductXmoA
NoteTssB
UniProt IDX5FUI7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.40E-52, Aligned region: 6..158
Protein Sequence: 166 a.a.     [Download]
>gi|611963679|ref|AHW84479.1| XmoA [Escherichia coli]
MADSFQNEVPTARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKVDINKNNFNSVMAEF
SPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDNATFRREL
ENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 501 bp     [Download]
>gi|611963678|gb|KF678349|xmoA|:1-501
ATGGCTGACAGTTTCCAGAATGAAGTTCCCACCGCTCGTGTAAATATCAAGCTTGATCTGCATACAGGCA
ATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCCGTAGGCGATTACAGTAACGGAAAAGAGCA
ACGTCCGCTGTCCGAACGGGACAAGGTTGATATCAATAAAAACAACTTCAACAGCGTCATGGCTGAGTTT
TCGCCTGCGGTTAATTTAACAGTAGAAGATACGCTAAACGGAAACGGTAATGAACAAAATATCGCGCTTG
AATTTAAAAGCCTGAAGGATTTTGAACCCGAACAGGTAGCAAAAAATATTCCGCAACTTCGTGTATTACT
CGCTATGCGCAATTTACTACGTGACCTGAAATCCAATCTGCTGGATAACGCAACGTTTCGCCGTGAACTG
GAAAATATTCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAACTGGCGAAAATTGCGCCGCAGG
AGAACGTTTAA