SecReT6
Protein ID: 611963686
SecReT6 ID904
T6SS typei2
Gene symbolxmoH
Locus tagxmoH
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678349] [Browse all T6SS(s) in this replicon]
Location [Strand]9178..11658 [+]
ProductXmoH
NoteTssI
UniProt IDX5FDR6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-63, Aligned region: 30..347
Phage_GPD [PF05954], Evalue: 1.90E-63, Aligned region: 441..470
DUF2345 [PF10106], Evalue: 7.60E-49, Aligned region: 602..751
T6SS_Vgr [PF13296], Evalue: 5.90E-37, Aligned region: 480..584
T6SS_Vgr [PF13296], Evalue: 5.90E-37, Aligned region: 596..615
T6SS_Vgr [PF13296], Evalue: 5.90E-37, Aligned region: 782..815
Phage_base_V [PF04717], Evalue: 3.90E-13, Aligned region: 392..473
Protein Sequence: 826 a.a.     [Download]
>gi|611963686|ref|AHW84486.1| XmoH [Escherichia coli]
MGIQNFDHSHHKLKIRGLKSPVDVLTFTGHEQLSSPFRYDIQFTSSDKAIAPESVLMQDGAFSLTAPPVQ
GMPVQTALRTLHGVITGFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNQTVPQIVEKILRERHQMR
GQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPL
RHPSGLFDGETEAVWGLNTAYSVVEKNVTTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQK
GDKEAAESGAFYARIRHERYLNEQAILKGQSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDAWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPGRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAVRAKKGIFISADAQDKAQGQ
VLDMTDALAQLREAQSLVEALCSATEVAKAELADLQTQKVMMSEALEELKKSAMLLSAPEGIAQVTPKSL
QLSAGENIISTSGKNSDFSVLKKFTVAAGETVSLFAQKLGIKIFAGKGKVEIQAQGDEMLLDALKDIRIS
SSEGRILISAKNEIILTSGGGYIRIGDGTVECAAPDKIIERGAVWQKFSGQSISQAMQQWDSADFAVTPE
ILWQQTGKPAKNQKVQVTRGDGSVVEMTTDEQGRLPIQSGLFVESIKIDLPDSQEN
 
Nucleotide Sequence: 2481 bp     [Download]
>gi|611963678|gb|KF678349|xmoH|:9178-11658
ATGGGTATTCAGAATTTCGACCACTCACACCACAAGCTCAAAATTCGCGGCCTGAAAAGCCCGGTGGACG
TGCTGACTTTTACAGGCCACGAACAGCTCAGCTCACCCTTCCGCTACGACATTCAGTTTACCAGCAGCGA
TAAAGCCATCGCGCCGGAATCGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCGCCCGTACAG
GGAATGCCGGTACAGACTGCCCTGCGCACCCTGCACGGCGTCATTACCGGCTTTAAACATCTCTCATCGT
CACAGGACGAAGCCCGTTACGAAGTGCGCCTTGAACCCCGTATGGCGCTGCTTACCCGCAGCCGCCAGAA
CGCCATCTACCAGAACCAGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGACACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGGCCCGCGAACAGGTGATGCAGTATGGCGAGG
ACGACCTGACGTTTGTCTCACGCCTGCTGTCGGAAGTGGGTATCTGGTTCCGCTTCGCCACCGACGCCCG
GCTGAAAATCGAAGTTATCGAATTTTACGACGACCAGAGCGGCTATGAGCGCGGGCTGACGCTGCCGCTT
CGCCATCCTTCTGGGCTGTTTGATGGTGAAACGGAAGCCGTATGGGGGCTGAACACGGCATACAGCGTGG
TGGAGAAAAACGTCACCACGCGGGACTACAACTACCGCACCGCCACAGCGGAGATGATGACAGAGCAGCA
TGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTATGCTGACAACTTCCTGCAAAAA
GGCGATAAAGAGGCAGCGGAAAGCGGCGCGTTTTATGCCCGTATCCGCCACGAACGCTACCTGAATGAAC
AGGCCATTCTCAAAGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATCAGGGTTCAGGGCGA
CGACGCGCCAGCGGTGTTCCGCAAGGGTGTGCTGATTACCGGCGTGACGGCCAGCGCGGCGCGTGACCGC
AGCTATGAACTGACGTTCACGGCGATACCCTACTCAGAACGCTACGGCTACCGCCCGGCGCTTATCCCCC
GCCCGGTAATGGCCGGCACGCTCCCGGCGCGGGTCACCAGCACGGTGAAGAACGATATTTATGCCCATAT
CGACAAGGACGGGCGCTACCGGGTCAATCTCGACTTTGACCGCGACGCATGGAAACCGGGTTATGAAAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCACCTGCCGCTGCTGGCGGGAA
CGGAGGTCAGCATCGCCTTTGAGGAAGGCAACCCGGGCCGACCTTATATTGCAGGCGTAAAACACGACTC
GGCGCACACCGACCATGTGACCATTCAGAACTACAAGCGCAACGTACTGCGTACCCCGGCCAACAACAAA
ATCCGGCTGGATGACGAACGCGGGAAGGAGCATATCAAGGTCAGCACCGAATACGGCGGCAAGAGCCAGC
TAAACCTCGGTCATCTGGTGGATGCCGGGAAACAGCAGCGCGGGGAAGGCTTTGAACTGCGTACCGATAT
GTGGGGCGCAGTGCGGGCGAAGAAAGGGATTTTTATCAGCGCCGATGCGCAGGACAAGGCGCAGGGTCAG
GTTCTGGATATGACTGATGCACTAGCTCAACTTCGCGAGGCACAGTCTTTGGTAGAGGCACTATGTAGTG
CTACTGAAGTGGCAAAGGCTGAACTTGCAGATTTGCAGACTCAGAAAGTAATGATGTCAGAGGCTCTGGA
GGAACTCAAAAAATCAGCGATGTTGCTTTCGGCTCCGGAAGGAATAGCTCAGGTTACGCCAAAAAGCCTG
CAGCTGTCCGCAGGAGAAAACATCATTAGCACCAGTGGAAAAAATTCAGATTTCAGCGTGTTGAAGAAGT
TTACCGTTGCTGCTGGAGAAACGGTAAGTCTGTTTGCCCAAAAGCTGGGGATAAAAATTTTTGCCGGTAA
GGGAAAAGTAGAGATTCAGGCGCAGGGAGATGAAATGTTGCTAGATGCGCTGAAAGATATCCGCATCAGC
AGCAGTGAGGGGCGAATCCTTATTAGCGCAAAAAACGAAATCATTCTGACCAGCGGCGGCGGATATATTC
GTATTGGTGATGGTACGGTGGAATGCGCAGCCCCAGACAAGATCATAGAGCGTGGGGCCGTATGGCAGAA
GTTCAGCGGCCAGAGCATCAGTCAGGCGATGCAACAGTGGGATTCTGCTGATTTTGCTGTCACACCAGAA
ATACTCTGGCAACAAACTGGCAAACCTGCAAAAAATCAAAAGGTACAGGTCACACGGGGTGATGGCTCAG
TGGTGGAAATGACCACCGATGAACAAGGACGATTGCCCATACAGTCAGGGCTTTTCGTTGAGTCAATAAA
AATTGATCTGCCGGATAGTCAGGAAAACTGA