SecReT6
Protein ID: 611963687
SecReT6 ID904
T6SS typei2
Gene symbolxmoI
Locus tagxmoI
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678349] [Browse all T6SS(s) in this replicon]
Location [Strand]11678..13447 [+]
Producthypothetical protein
NoteTle4 (e)
UniProt IDX5F6C2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PGAP1 [PF07819], Evalue: 2.30E-07, Aligned region: 25..37
PGAP1 [PF07819], Evalue: 2.30E-07, Aligned region: 227..263
LCAT [PF02450], Evalue: 6.90E-05, Aligned region: 245..296
LCAT [PF02450], Evalue: 6.90E-05, Aligned region: 381..424
LCAT [PF02450], Evalue: 6.90E-05, Aligned region: 525..565
Abhydrolase_6 [PF12697], Evalue: 0.0028, Aligned region: 240..272
Protein Sequence: 589 a.a.     [Download]
>gi|611963687|ref|AHW84487.1| hypothetical protein [Escherichia coli]
MTSTMHMDRADKNKVGTVEIEDLRVIPVIFLPGVMGSNLMDKKGKSIWRYDDSMSLMGWSLPTSGPKERK
RLLHPDRVEVDNRGRIPAPPDAQEKLIQLGQQYPEDPSDKEAMDNYTQAVRDILDNIEPEAKLFGSRKDR
GWGEVANASYGSFLDVLQTALYRDKPTKKGETLSATYQQLLDVPLGLEYGPDSLDEEYLEVIRLYQFPVH
VVGYNWLGSNMLSAIRLQEQIKKIVGGYQKRGMKCHKVILVTHSMGGLVARYFSECLSGNTDVYGIVHGV
LPSIGAAATYTRMKRGTENPESNPEGYVISHILGRNAAEMVAVFSQSPGPMELLPMNDYGEEWLNIVDRD
GSTLTLPKNLPIKEGIAPEERTYAELYLNRENWWKLVDENLLNPFNTSLNQKQIDTDWNIYENLITESVN
PFHKQIAGKYHINTYSFYGRAKLGDIPEAHLTQENVLWKGSLSMGKKSDISLEPKFIDGRLDLNEVGNIR
PIKDEFSPEEQAWEINTDDGDTYVKIGQRFTLRDSCENGDGTVPLRAGQIVHKNILERLAVQVSHEAAYR
NPVSQAFALRSIIKIAQEVKKDGKMSYSD
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|611963678|gb|KF678349|xmoI|:11678-13447
ATGACATCGACGATGCATATGGACAGGGCCGATAAGAATAAAGTTGGCACCGTTGAAATTGAGGATCTAC
GGGTTATTCCGGTTATTTTTCTGCCCGGAGTCATGGGTTCAAACCTTATGGATAAGAAAGGAAAATCCAT
CTGGCGATATGATGACTCTATGAGTCTGATGGGCTGGTCACTACCTACATCAGGACCAAAAGAGAGGAAA
AGATTATTGCATCCTGACAGGGTGGAGGTCGATAATCGTGGGAGAATTCCCGCACCTCCGGATGCCCAAG
AAAAACTTATTCAGTTAGGTCAACAATATCCGGAGGACCCATCCGATAAAGAAGCAATGGATAATTACAC
TCAGGCAGTACGTGACATTTTGGATAATATAGAGCCAGAAGCGAAATTATTTGGTTCAAGAAAAGATCGC
GGCTGGGGAGAGGTTGCAAATGCTAGCTACGGTTCCTTTCTCGATGTATTACAAACAGCATTGTACCGGG
ACAAACCTACAAAGAAAGGTGAGACGTTAAGTGCGACCTACCAGCAACTACTCGATGTACCTTTGGGTTT
GGAGTATGGTCCTGACTCACTTGATGAAGAGTATCTTGAAGTCATAAGGTTGTATCAATTTCCGGTCCAT
GTCGTTGGCTATAACTGGCTTGGTTCTAATATGCTCTCAGCAATCAGACTACAAGAACAGATCAAGAAAA
TTGTTGGAGGCTATCAAAAACGAGGAATGAAATGCCATAAAGTTATTCTGGTTACGCATTCAATGGGAGG
ACTAGTGGCAAGGTACTTTTCAGAGTGTCTTTCGGGGAATACGGATGTCTACGGTATTGTTCATGGCGTA
TTACCATCAATTGGTGCTGCGGCGACATATACCCGAATGAAACGTGGAACTGAAAACCCAGAGTCAAATC
CGGAAGGGTATGTTATCAGTCATATCTTAGGTCGTAATGCAGCTGAAATGGTAGCTGTTTTTTCCCAGTC
GCCAGGACCAATGGAATTACTACCCATGAATGATTATGGTGAAGAGTGGCTTAATATTGTCGATCGTGAT
GGTAGTACATTAACGCTCCCTAAAAATCTTCCCATTAAAGAAGGTATTGCCCCCGAAGAACGCACCTACG
CTGAACTTTATCTAAATAGAGAAAATTGGTGGAAATTGGTGGATGAGAATCTATTGAATCCTTTTAATAC
TTCATTAAATCAAAAGCAAATTGATACTGATTGGAATATATATGAAAATTTAATTACTGAGAGTGTCAAT
CCATTTCATAAGCAAATTGCTGGAAAATATCATATCAATACTTACTCTTTCTATGGGAGAGCGAAATTGG
GAGATATTCCTGAAGCGCATTTAACGCAGGAAAATGTTCTTTGGAAAGGCTCATTATCAATGGGAAAAAA
AAGTGATATATCTTTAGAACCAAAATTCATTGATGGTCGTCTTGATTTAAATGAAGTTGGTAACATTAGA
CCTATTAAGGATGAATTTTCTCCTGAAGAACAGGCGTGGGAAATAAATACTGACGACGGTGATACATATG
TTAAGATAGGACAGCGTTTTACATTACGAGACTCTTGTGAAAACGGGGATGGTACAGTACCTCTTCGTGC
AGGACAAATCGTACACAAGAACATCCTAGAGCGTTTGGCTGTACAGGTTTCTCACGAGGCTGCTTATCGA
AATCCCGTTAGTCAGGCATTTGCATTACGTTCTATTATAAAAATAGCTCAGGAGGTAAAAAAGGATGGTA
AAATGTCATACTCTGATTAA