SecReT6
Protein ID: 611963688
SecReT6 ID904
T6SS typei2
Gene symbolxmoJ
Locus tagxmoJ
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678349] [Browse all T6SS(s) in this replicon]
Location [Strand]13422..14132 [+]
Producthypothetical protein
NoteTli4 (i)
UniProt IDX5FD89
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 236 a.a.     [Download]
>gi|611963688|ref|AHW84488.1| hypothetical protein [Escherichia coli]
MVKCHTLINRRNKCLLIVFIVLIGWIIFRPKAYTYSLNDKEKEMLIMLSQHPETRYFGFYSIELPADYKP
TGMVMFIQGSAMIPVETKLQYYPPFLQYMTRYEAELKNTSALDPLDTPYLKQVHPLSPPMNGVIFERMKA
KYTPDFARVLDAWKWENGVTFSVKIEAKDGRATRYDGISKIAEYSYGYNIPEKKYSYLLFFQDYNLVQIT
NPHQKINWRYNMHRLTLHYLESMNYL
 
Nucleotide Sequence: 711 bp     [Download]
>gi|611963678|gb|KF678349|xmoJ|:13422-14132
ATGGTAAAATGTCATACTCTGATTAACCGTAGAAATAAATGTCTGCTGATTGTTTTTATAGTCCTTATTG
GATGGATTATATTCAGACCTAAAGCATATACTTATTCACTAAATGATAAAGAAAAAGAGATGCTCATAAT
GTTATCACAACATCCTGAAACTCGGTACTTTGGATTTTATTCCATAGAACTTCCGGCTGATTACAAACCA
ACAGGAATGGTTATGTTCATACAAGGATCGGCGATGATCCCTGTAGAAACAAAGCTACAATATTATCCTC
CTTTTCTGCAATATATGACACGATATGAGGCAGAACTAAAAAACACCTCAGCATTAGATCCACTGGATAC
GCCTTATTTGAAGCAAGTTCACCCACTAAGTCCACCTATGAATGGAGTCATTTTTGAACGAATGAAAGCG
AAATACACCCCAGATTTTGCACGAGTATTGGATGCATGGAAATGGGAAAATGGCGTTACGTTTTCAGTAA
AAATAGAAGCTAAAGATGGTAGAGCAACCCGCTATGATGGAATTAGTAAGATTGCCGAATACAGTTATGG
ATATAATATTCCAGAAAAAAAGTACAGTTACTTACTATTCTTTCAGGACTACAACCTCGTGCAGATAACC
AACCCCCATCAGAAAATAAATTGGCGATACAATATGCACAGGTTGACGCTTCACTACTTGGAGAGTATGA
ATTATCTGTAG