SecReT6
Protein ID: 611963693
SecReT6 ID904
T6SS typei2
Gene symbolxmoO
Locus tagxmoO
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678349] [Browse all T6SS(s) in this replicon]
Location [Strand]19707..21344 [+]
ProductXmoO
NoteTssA
UniProt IDX5FD95
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.90E-20, Aligned region: 76..135
Protein Sequence: 545 a.a.     [Download]
>gi|611963693|ref|AHW84493.1| XmoO [Escherichia coli]
MRKSMGKTPMSELLQKLTRSCFADRDALDVARTQAALWQTWLLPVTADTPVGEDPGYHDDFLRIRDEMNK
LSGTDTGLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRK
MALEWLAGEKMLDSLARYPEVAKEDFANIVAALNQLTVSFTAWPEDQHSPSLMPLINALESRLAQSGGMN
AVVPQNSSSVTAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPD
VDGKTRLAPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAV
IRQDLALLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEA
LAMADSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPE
LLFEVKARQLKLLRLRAHRYADKALLNRKMEILLGTLVAIDPARAAVLCDTQHKD
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|611963678|gb|KF678349|xmoO|:19707-21344
ATGCGGAAGAGTATGGGGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGCCG
ACCGGGATGCACTGGATGTGGCGCGAACACAGGCGGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGC
AGACACGCCGGTCGGGGAAGACCCCGGCTACCACGACGATTTCCTGCGTATACGCGACGAAATGAACAAA
CTTTCCGGCACAGATACCGGCCTTATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCCAAAGACG
TGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCGGAAGGACT
GGCGCTGCTGACCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGTCCGGCCAGCCGGAAA
ATGGCGCTGGAGTGGCTGGCAGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAG
AGGATTTTGCGAACATTGTTGCCGCTCTTAATCAACTGACGGTTTCCTTCACTGCATGGCCCGAAGACCA
GCATTCCCCCTCCCTGATGCCACTGATTAACGCGCTGGAATCACGTCTGGCGCAGTCGGGCGGGATGAAC
GCGGTGGTGCCGCAAAACAGCAGCAGCGTTACTGCACCGTCATCCCCGGTGGATGCGCCACAGGTACAGA
CCATCACCTCCGGGCGTGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCA
GGGCTGGCTTTCGGCGCACCGGCTGATGAAAACCCTGCGCTGGGACACGGTGCATGAACTGCCGCCGGAT
GTGGACGGCAAAACCCGGCTGGCCCCGCCGCGCACCGAGTCACGCAACCAGCTTAAGCGGCTGTATGCCC
AGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGCGTCAGCCATTTCTGGCT
GGATATCCAGTGGTATCTGCATCAGGCGCTGACTAAGGCGGGCGTACCGTGGGACAGGTGGACAGCTGTT
ATCCGTCAGGACCTGGCGTTACTGCTGGAACGCCTGCCAGGGCTGGAAAATCTGGCATGGAACGACGGCA
CGCCGTTCGCCGATGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATG
GCTTGCGGGGAAAGCCGCTGTACCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCA
CTGGCGATGGCAGACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCA
CGGCACGACAGCGCCTGTTATTGCGACTGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAGAT
GGCGCTCCTGCTGCTGGAAGAACTGGATACCGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCAGAA
CTGCTGTTTGAAGTAAAAGCCCGGCAACTGAAACTGCTGCGTCTGCGGGCGCACCGCTATGCGGATAAAG
CCCTGCTGAACCGAAAAATGGAAATCCTGCTGGGAACGCTGGTGGCAATCGATCCGGCACGGGCAGCGGT
ACTGTGTGATACGCAACATAAGGACTGA