SecReT6
Protein ID: 611963697
SecReT6 ID904
T6SS typei2
Gene symbolxmoS
Locus tagxmoS
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678349] [Browse all T6SS(s) in this replicon]
Location [Strand]24626..26386 [+]
ProductXmoS
NoteTssF
UniProt IDX5F6J3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.60E-186, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|611963697|ref|AHW84497.1| XmoS [Escherichia coli]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLSDFQVLSRPVGERRTRCVYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFACGPLVGDWSQIDLSRLPLYLNADSPVACALHRALTLGTQQFWLRLPGQDR
RMLGAHFSPMGFEDDDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLEQVAWPEGITGFEIDVVLNE
NWPHDLPFDSDNIRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDSDRMLEDETLSLSLTGTNGQLPR
KALQSTLLDTPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|611963678|gb|KF678349|xmoS|:24626-26386
ATGGACGACCTGACCCAACGCTACTATGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGTAAAGAATTCG
CACAGGCGTATCCCGACCGTGCTGCGATGCTTAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
GCGCCTGTTCGAGGGCTTCGCTTTTTTAATGGGCCGCCTGCGCGAAAAGCTGGACGACGATCTGCCGGAA
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCCCACTACCTGCGAACCATCCCGTCACTTTCCGTGGTTG
AACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAGCGATTTTCAGGTATTGTCGCGCCC
TGTTGGCGAGCGCAGAACCCGCTGCGTCTACAGTGCCACGCGTGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGCTCGGTTATCCGTCTGCGCTTTGCGTGCGGCCCGC
TGGTTGGTGACTGGTCGCAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGACAGCCCGGTAGC
CTGTGCGTTGCACCGGGCTTTAACGCTTGGCACGCAGCAGTTCTGGCTGCGTCTGCCGGGGCAGGATCGC
CGGATGCTTGGCGCACACTTTTCCCCGATGGGCTTTGAGGATGATGACAGGCTCTGGCCAAAAGGTGAGT
CAGCCTTCAGCGGTTACCAGTTGCTGCTGGAGTATTTCACCTTCCGCGAGAAGTTTATGTTCGTGGCGCT
GAACGGGCTGGAGCAGGTTGCATGGCCGGAGGGGATAACCGGCTTTGAGATTGACGTGGTGCTGAACGAG
AACTGGCCTCACGACCTGCCGTTTGACAGCGATAATATCCGTCTGCACTGCGTGCCGGTCATCAACCTGT
TCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCACTGGAAAACGAATTTCTGCTACGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCA
TATGTCCCCTTTTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGCTTGCACGACACATGGCTGATTCTGGGCGGCGATGCGTTTGA
TTCCGACCGGATGCTGGAGGATGAAACCCTGTCCTTAAGTCTGACCGGCACCAACGGGCAGCTTCCCCGT
AAAGCCTTACAGAGCACCCTGCTCGATACGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCAACC
TGTGCGCCCCGACGCAGCCCTGCTATCCCCCGGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGCCACCT
CGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGCACGCTGGCGCTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTCTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTGACCTTAATTCTGCAACCCACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA