SecReT6
Protein ID: 611963698
SecReT6 ID904
T6SS typei2
Gene symbolxmoT
Locus tagxmoT
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678349] [Browse all T6SS(s) in this replicon]
Location [Strand]26350..27429 [+]
ProductXmoT
NoteTssG
UniProt IDX5FDF4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-81, Aligned region: 19..319
Protein Sequence: 359 a.a.     [Download]
>gi|611963698|ref|AHW84498.1| XmoT [Escherichia coli]
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQKAPLGSTDNPAADAVRFRPHPGMGFPVSELKNV
ERDVDNPDAPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYP
ASFEAGAVDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVV
PHDPQPVILPAPAGLSKNSRISLKTRTLLGRTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLR
VYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPAFSIRNRE
SMTHVSYSF
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|611963678|gb|KF678349|xmoT|:26350-27429
ATGGACAGAGCATCACAGCCAGCGCGTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGGATCA
ATTTTTACCGTTTTTGCCAGTTGCTGGAACAGAGCCAGCAGAAAGCGCCGCTGGGCAGTACCGACAACCC
CGCCGCCGATGCGGTGCGTTTTCGCCCCCATCCCGGAATGGGCTTTCCGGTCAGCGAGTTAAAGAACGTT
GAACGTGACGTGGACAATCCCGACGCGCCACCCACGGTGCGCACCACCTTTCTCGGCCTGTACGGCGTGG
ATTCACCGCTGCCCACCGCCTATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCAGTGATGGC
GTTTCTCGATATTTTTAACCATCGCTTTATCACCCAGTATTACCGCATCTGGCGCAAATATAACTACCCG
GCGTCGTTTGAAGCAGGTGCCGTGGATGACATTTCCCGTTGTCTGCTGGGGTTAATCGGGCTGGGTATTC
CCGGCAGCGAGAACCATATCGCCACGCCTGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCC
CACCCGCACGGCTGAAGGCGTCACGGCACTGGTGGGGCTGCTTGCCCCGCTGACGAAAGCCACGGTGGTG
CCTCACGATCCGCAGCCTGTAATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACGCATCAGCCTGA
AAACGCGAACGCTGCTGGGGCGTACCGGTACCGACGTCAACAGCCAGTTGCTGCTGAAACTGTATACCGA
AGATGCCGCAGAAGCACGTGGCTGGCTGCCCGGCGGGCAACTGCACAGCGATTTGCTGGTGCTGCTGCGC
GTTTATCTGGGCTGGCGCTGTCAGGCCCGTCTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCC
GGCTGGGAAAACAGCGTGTACAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGAC
CGGAACAGTGACGGTCAGTCTGGGGCGTTATCAGGGATTAATACCCGCTTTTTCCATTCGTAACAGGGAG
AGTATGACTCATGTTTCCTATTCGTTTTAA