SecReT6
Protein ID: 611963703
SecReT6 ID905
T6SS typei1
Gene symbolxmtA
Locus tagxmtA
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678350] [Browse all T6SS(s) in this replicon]
Location [Strand]1..480 [-]
ProductHcp-like protein
NoteTssD
UniProt IDQ6TKT6
KEGG IDelf:LF82_013
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.90E-31, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|611963703|ref|AHW84502.1| Hcp-like protein [Escherichia coli]
MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVTSLSHGLSRAQNVNHQELTITKPVDKSSP
LLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLANARLSNIGLTVPHTINDSPGQAEESVSFTYESIN
WEHSVAGTSAYSLWSERIF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|611963702|gb|KF678350|xmtA|:1-480
ATGGCAAATCCCGTCTATCTGACACTGAACGGAGAACTTCAGGGGCTGATTTCATCCGGATGCTCGTCAA
TGCCGTCCATCGGTAACAAAGCCCAGATTGCACATCAGGATCAGATCATGGTGACGTCACTGTCCCATGG
TCTGAGCCGTGCGCAGAATGTCAACCATCAGGAGTTGACCATCACGAAACCGGTGGACAAATCCTCCCCT
CTGCTGGGCAAGGCCATTTCAGAGAATGAATGTCTGACCTGTGATTTTGTATTCTACCGCACCAACCGCT
TTGGAATTAATGAACCGTACTACAAGCTGAAACTGGCTAACGCCCGGCTCTCAAACATCGGCCTTACCGT
TCCCCATACCATTAACGACAGTCCAGGGCAGGCGGAAGAGTCTGTGTCATTTACCTATGAGAGCATCAAT
TGGGAGCACAGCGTCGCCGGAACCAGTGCATACAGCCTTTGGAGTGAACGGATTTTCTAA