SecReT6
Protein ID: 611963704
SecReT6 ID905
T6SS typei1
Gene symbolxmtB
Locus tagxmtB
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678350] [Browse all T6SS(s) in this replicon]
Location [Strand]498..1940 [-]
ProductXmtB
NoteTssA
UniProt IDQ6TKT7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.60E-45, Aligned region: 119..184
DUF3702 [PF12486], Evalue: 2.60E-45, Aligned region: 286..299
DUF3702 [PF12486], Evalue: 2.60E-45, Aligned region: 316..462
ImpA-rel_N [PF06812], Evalue: 9.20E-21, Aligned region: 69..129
Protein Sequence: 480 a.a.     [Download]
>gi|611963704|ref|AHW84503.1| XmtB [Escherichia coli]
MWIPKITRSPAVCSACSVYRIRCIKGIVMSNYALTQTIVTGSDPRALPEFSAIREEINKANHPSQPELNW
KLVESLALSIFKANGVDLHTATYYTLARTRNQGLAGFCEGAELLAAMIIHEWDKFWPQSGPARTEMLDWF
NTRTGNILRQQVSFSENDLSLLYRTERALQLICDKLQQVELKRQPRVENLLYFVQNTRKRFEPQPRNRTD
TAAQTMVRTLVYAPEGTASATAETMPPLPDLPEMRVGVRGVADNADKAKQGDTVKGFVAGAACTAVIASA
LWWWQAYPMQQQLTQVRDTTQGAATVWLASPVLKEYEQYLQQLLNAPPLQPLETGMQMMRTADTLWPESL
QQQEASRMWSNTLRNRAQASPQMKGWQQARQNLRDFADLMMKKETEKQGFTLSYIKTVTWQAERLLNQET
PLEYLLTQYQETRTQKQDTQALEKEINERLDGLLSRWLLLKNTGQDMATDNRTEPVHPTH
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|611963702|gb|KF678350|xmtB|:498-1940
ATGTGGATACCGAAGATAACCCGTTCACCGGCGGTCTGTTCAGCCTGTTCCGTTTACCGGATACGTTGTA
TTAAGGGGATAGTGATGAGCAATTACGCACTGACACAAACTATCGTTACCGGCAGCGATCCGCGCGCCCT
GCCGGAGTTCAGCGCCATCCGCGAAGAAATTAACAAAGCTAACCACCCGTCACAGCCGGAGCTGAACTGG
AAACTGGTGGAATCGCTGGCGCTGTCGATTTTTAAGGCCAACGGGGTGGATTTGCATACCGCCACCTACT
ATACGCTGGCACGTACACGTAATCAGGGACTGGCAGGGTTCTGTGAAGGCGCGGAACTGCTGGCTGCGAT
GATCATCCACGAATGGGATAAATTCTGGCCGCAGAGTGGTCCGGCGCGGACTGAGATGCTGGACTGGTTC
AACACCCGCACCGGGAATATCCTGCGCCAGCAGGTTTCCTTTTCCGAAAATGATCTTTCGTTGCTCTACC
GCACGGAACGGGCTTTGCAGCTTATCTGCGACAAACTCCAGCAAGTGGAACTGAAGCGCCAGCCGCGCGT
GGAAAATCTGCTTTATTTTGTGCAGAACACACGCAAGCGGTTTGAGCCGCAGCCCAGAAACCGTACTGAT
ACGGCGGCACAGACCATGGTCAGAACGCTGGTCTATGCGCCTGAAGGCACGGCTTCCGCCACAGCGGAAA
CCATGCCCCCCCTACCCGACCTGCCGGAAATGCGGGTGGGGGTGCGCGGTGTGGCAGATAACGCCGACAA
AGCAAAACAGGGCGACACGGTAAAAGGTTTTGTTGCCGGTGCCGCCTGTACTGCCGTTATCGCATCTGCA
CTCTGGTGGTGGCAGGCGTATCCGATGCAGCAGCAGCTTACACAGGTCAGGGATACCACACAGGGAGCCG
CCACCGTCTGGTTGGCATCCCCGGTACTGAAAGAATATGAACAGTACCTGCAACAGCTTCTGAATGCCCC
GCCACTACAGCCGCTGGAAACCGGAATGCAGATGATGCGCACCGCAGACACCCTCTGGCCGGAAAGCCTG
CAACAGCAGGAAGCCAGCAGGATGTGGAGCAACACGCTGAGAAACCGGGCGCAAGCCAGTCCGCAGATGA
AGGGCTGGCAACAAGCGCGGCAGAATTTGCGGGATTTTGCAGATTTGATGATGAAGAAGGAGACGGAGAA
ACAGGGTTTCACCCTATCGTATATCAAAACGGTGACCTGGCAGGCCGAACGGTTACTGAATCAAGAAACA
CCACTGGAGTACCTGCTGACGCAGTACCAGGAGACCCGTACACAGAAGCAGGACACACAGGCGTTGGAAA
AAGAGATCAACGAACGGCTGGACGGGCTGTTAAGCCGCTGGCTGCTGCTGAAAAATACCGGACAGGATAT
GGCAACGGATAACAGAACCGAACCTGTCCATCCAACTCATTGA