SecReT6
Protein ID: 611963706
SecReT6 ID905
T6SS typei1
Gene symbolxmtD
Locus tagxmtD
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678350] [Browse all T6SS(s) in this replicon]
Location [Strand]5414..6856 [-]
ProductXmtD
NoteTssA
UniProt IDQ6TKT9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.00E-06, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 1.00E-06, Aligned region: 406..417
Protein Sequence: 480 a.a.     [Download]
>gi|611963706|ref|AHW84505.1| XmtD [Escherichia coli]
MAMDLRNPDVWLAHLLENLPEDKLSAALDDGNADWEFVDSEIVKLGSLAHSQLDIPELQRRGLMLLASET
KDFRLLAHLLRTLQHAGDILLASRMLAQYTEHYWTCAAPQNMAHKKRFAAQVIKRFESAVQDFAGNAATI
QRDALLGELAKLAQCWQAHNASELAKATDDLFSLFQRAFRDVAPEMTSSARSAAIAPQATTGYVPDMSPH
TVAAQPPVAATPIPQVTVENHDDKAWRDTLLKVAAILCERQPESPQGYRLRRHALWQTITSTPQAESDGR
TPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPYWLDGHYLSAQTALRLGYKQVADAIRDEVTDFL
ARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAAKACFDENGLEAALRYLENLPEG
DPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSLLKALEQKLTAEQ
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|611963702|gb|KF678350|xmtD|:5414-6856
ATGGCAATGGACTTACGTAATCCCGATGTATGGCTTGCACACCTGCTGGAAAACCTGCCAGAAGATAAGC
TGTCCGCCGCGCTTGATGATGGCAATGCAGACTGGGAGTTTGTCGACAGCGAAATCGTCAAGCTCGGTTC
ACTGGCGCACAGCCAGCTTGATATCCCGGAACTTCAGCGCCGGGGCCTGATGCTTCTGGCCTCAGAAACC
AAAGATTTTCGCCTGCTGGCCCACTTGCTGCGTACCCTGCAACATGCCGGTGATATTCTGCTGGCCTCCA
GGATGCTGGCACAATATACAGAGCACTACTGGACATGCGCCGCACCGCAGAACATGGCCCACAAAAAACG
CTTTGCCGCCCAGGTGATAAAACGCTTTGAGTCTGCCGTTCAGGACTTTGCCGGGAATGCTGCGACAATA
CAGCGCGATGCTTTGCTGGGAGAGCTGGCAAAACTGGCACAGTGCTGGCAGGCGCACAACGCGTCTGAGC
TGGCAAAGGCGACAGACGATTTATTTTCCCTGTTTCAGCGCGCGTTTCGTGATGTAGCGCCTGAAATGAC
ATCATCTGCACGAAGCGCCGCCATAGCGCCGCAGGCCACGACCGGATATGTACCGGATATGTCACCGCAC
ACGGTTGCCGCTCAGCCTCCTGTTGCAGCCACTCCAATCCCGCAGGTCACCGTTGAAAACCACGACGATA
AAGCATGGCGCGACACCCTGCTAAAGGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGAGTCACCGCAGGG
TTACCGACTGCGCCGCCATGCGCTGTGGCAAACCATCACCAGTACCCCGCAGGCAGAAAGCGATGGCCGG
ACCCCACTGGCAGCCTTCCCTGTCGATATGATGGATGATTACCTGGCGCGGCTGAACAATGCCGACATGG
CGCTGTGGCAGCAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTGGACGGTCATTACCTCTCAGC
ACAGACCGCGCTGCGCCTCGGTTATAAACAGGTGGCGGATGCTATCCGTGATGAAGTTACCGATTTTCTG
GCCCGCCTGCCCGCACTGATCAACCTGTTGTTTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAAC
AGTGGCTGGCATCATCCGGCTCAGTCAACCAGACCGTCCCGGTTGTACAGACCGATGAAGAATTACAGGC
GGCCAAGGCGTGCTTCGATGAAAACGGGCTGGAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGT
GATCCCCGCCACCAGTTTCACCGCCAGTTTTTCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGC
TTGCACAACAGCAGTACCGGATGCTCTTCAGAACAGGATTACACATGATGCTATCCGAATGGGAGCCTTC
CCTGCTGAAAGCACTGGAACAAAAACTCACGGCAGAACAGTAA