SecReT6
Protein ID: 611963710
SecReT6 ID905
T6SS typei1
Gene symbolxmtH
Locus tagxmtH
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678350] [Browse all T6SS(s) in this replicon]
Location [Strand]11156..12502 [-]
ProductXmtH
NoteTssK
UniProt IDQ6TKU3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.60E-142, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|611963710|ref|AHW84509.1| XmtH [Escherichia coli]
MATMKNKVIWQEGLFALPQHFQQQQRHCEYLLTRRLDALGDFFWGFTELSINTELLAQGKIMIDRAAGCM
PDGTVFSIPDQDLLPEPFQPGTLSSKESHNIYLALPVISDVINEIQGLHSAGQGTERYRLTHTRVRDFHT
DEGDEQPVGLGQLIPRIVSGADDLSAMVTLPLCRILNKNATGALVLDNTFIPTIQAVRVSGLLGAFSGEV
QGLLATRAADLAGRIGSPEQSGIADVAEFMMLQMLNRYQMQFTHRSQLHTLHPEAFYRDLVGLLGELMTF
TEGNRLPCTVEPYNHRDLTATFTRTVIPELRRALNTVLVPRAQNLPLFFSEGTWIATINDPTLLQSCKLV
LAVRARMPYDQVQRQFIQQSKVAATDKIRSVVSVQVPGIPLHTLTAAPRQLPYHEGYVYFELEKGTPAWQ
DVIKAGALALHISGSFPDLNLQLWAIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|611963702|gb|KF678350|xmtH|:11156-12502
ATGGCAACAATGAAAAACAAAGTGATCTGGCAGGAAGGGCTGTTTGCCCTGCCGCAGCATTTTCAGCAAC
AGCAGCGTCACTGCGAGTACCTGCTGACCCGTCGTCTGGATGCACTGGGTGATTTTTTCTGGGGTTTTAC
GGAACTCTCCATCAATACAGAACTGCTTGCCCAGGGCAAAATCATGATTGACCGTGCGGCGGGCTGTATG
CCTGACGGCACCGTATTCAGCATTCCCGACCAGGATCTGCTGCCGGAACCTTTCCAGCCGGGAACCCTTT
CATCGAAAGAGAGCCACAATATTTATCTGGCGCTGCCGGTGATAAGCGACGTGATCAATGAAATCCAGGG
GTTGCACAGCGCCGGTCAGGGTACGGAGCGTTACCGCCTCACCCATACCCGCGTCCGTGATTTTCACACT
GACGAAGGCGACGAACAGCCAGTCGGTCTGGGGCAGTTGATCCCCAGGATAGTCAGCGGCGCAGATGATC
TCAGCGCGATGGTGACTCTCCCCCTGTGCCGTATCCTCAATAAAAATGCCACCGGCGCGCTGGTGCTGGA
CAACACCTTTATTCCCACCATTCAGGCCGTCCGTGTCAGCGGGTTGCTCGGGGCATTCTCCGGCGAGGTG
CAGGGACTGCTTGCCACCCGCGCCGCTGACCTGGCCGGGCGCATTGGTTCGCCTGAACAGAGCGGGATCG
CCGATGTGGCCGAATTTATGATGTTGCAGATGCTTAACCGCTATCAAATGCAGTTCACGCATCGTTCCCA
ACTGCACACGCTGCATCCGGAAGCCTTCTACCGGGATCTGGTGGGGCTGCTGGGAGAACTGATGACCTTT
ACCGAAGGTAATCGCCTGCCCTGCACCGTGGAGCCGTATAATCACCGGGATCTTACCGCGACCTTCACCA
GAACCGTGATCCCGGAACTGCGGCGCGCGCTCAATACCGTACTGGTGCCGCGTGCGCAGAATCTGCCGTT
GTTCTTTTCAGAGGGGACCTGGATCGCCACCATCAACGATCCCACATTGTTGCAGTCCTGCAAGCTGGTA
CTGGCAGTGCGCGCCAGGATGCCCTACGACCAGGTACAACGCCAGTTCATCCAGCAGTCGAAAGTGGCCG
CTACCGACAAAATCCGCAGCGTGGTCAGCGTGCAGGTGCCGGGTATTCCGCTGCACACGCTTACCGCTGC
GCCACGTCAGTTGCCATACCACGAAGGTTATGTTTACTTCGAACTGGAAAAAGGCACCCCGGCCTGGCAG
GACGTGATAAAAGCGGGCGCACTGGCGCTGCATATCTCCGGCAGCTTCCCCGATCTGAACCTCCAGCTCT
GGGCTATAAGGGGATAA