SecReT6
Protein ID: 611963714
SecReT6 ID905
T6SS typei1
Gene symbolxmtL
Locus tagxmtL
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678350] [Browse all T6SS(s) in this replicon]
Location [Strand]15336..17042 [-]
ProductXmtL
NoteTssF
UniProt IDX5FDC0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.70E-170, Aligned region: 1..568
Protein Sequence: 568 a.a.     [Download]
>gi|611963714|ref|AHW84513.1| XmtL [Escherichia coli]
MEAFAFMSGSLRQKLEDEFPEFTHGLIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSE
KSSLTAQKVLPDNHDKIVSSVACHFTLARDIWLQPLRILDTRNASSLKEGIIDISFTADNNVSPAMLDLN
KITFWLGNEDDYTRHQLYLWFCECLMDAELIAGEYRLPLPDLWLEAAGFDNRDALLPWPKNVHSGYRVLQ
EYFCYPEAFFFFHLRDVAPLPDDFPINAFTLRLHFNRPLPADIKLRQDSLRLHCTPAINLFTHYAEPVRP
DGRMAEYPLRASHKHPDAYDIFQVSTVTSKVKVSGTEISPGSQARVWPEFESFQHQMEYSRQREVVYWHH
RTKTSLLHHGLEHSIAFVHADGSIPGSSRFNDDVITTSLICTNRMIPARLHTGDICVAVNKNPAVASFRN
VTRPTLPLWPVTDGDMHWSLISAMNLNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLET
KPVDRLFKGVPVRGLATTLWIRPDPFICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQESWEWQE
KMGQHALI
 
Nucleotide Sequence: 1707 bp     [Download]
>gi|611963702|gb|KF678350|xmtL|:15336-17042
ATGGAAGCCTTTGCCTTTATGTCCGGTAGCCTGCGCCAGAAACTTGAGGACGAATTCCCCGAGTTCACCC
ATGGGCTGATCCGTATGCTGTGGGCAAACTATTTACGCCCGGTTCCGGCCATGACGGTTATTGCCTATGA
ACCCAAAACCGATCAGTTAAAAGTCCCTGTTCAGGTCTGTCGTAATGAACTGATCAGAAGCCGCTCAGAA
AAGTCCTCCCTGACTGCTCAGAAGGTGCTGCCTGACAATCATGATAAAATCGTTTCTTCCGTAGCCTGCC
ATTTCACGCTGGCGCGCGATATCTGGCTGCAACCACTGCGCATTCTCGATACCCGCAACGCCAGCAGCCT
GAAAGAAGGCATCATAGATATCAGTTTTACCGCAGATAACAATGTCTCCCCCGCCATGCTTGACCTGAAC
AAAATCACGTTCTGGCTGGGTAATGAAGACGATTATACCCGACACCAGCTTTATCTGTGGTTTTGCGAAT
GCCTGATGGATGCGGAACTGATTGCCGGAGAGTACCGCCTGCCGCTGCCGGATCTGTGGCTGGAGGCGGC
GGGTTTTGACAACCGGGATGCTCTGCTGCCGTGGCCGAAAAATGTCCACAGCGGCTACCGCGTGCTTCAG
GAGTATTTCTGCTATCCCGAAGCCTTCTTCTTTTTCCATCTGCGCGATGTTGCGCCGCTACCAGACGATT
TCCCGATCAATGCGTTTACGCTGCGCCTGCACTTTAACCGCCCGTTACCTGCCGACATCAAGCTGCGCCA
GGATTCGCTGCGTCTGCACTGTACGCCAGCCATTAACCTGTTTACGCATTATGCGGAACCCGTCAGGCCG
GATGGGCGGATGGCGGAATACCCGCTGCGCGCCAGCCATAAGCATCCGGACGCCTATGACATTTTTCAGG
TCAGCACAGTCACCAGTAAAGTCAAAGTTTCAGGTACTGAAATCAGCCCAGGTAGCCAGGCGCGTGTCTG
GCCCGAATTTGAAAGCTTCCAGCACCAGATGGAGTACAGCCGCCAGCGAGAAGTCGTCTACTGGCATCAC
CGGACTAAAACGTCCCTGCTTCACCACGGGCTTGAACACTCTATCGCCTTTGTCCATGCAGACGGTAGCA
TTCCGGGCAGCTCACGGTTTAACGATGACGTGATCACCACGTCATTAATCTGTACCAACCGTATGATCCC
TGCCCGGCTGCATACCGGTGATATCTGCGTGGCCGTCAACAAAAATCCGGCAGTGGCCTCATTTCGTAAT
GTCACGCGCCCGACACTGCCGCTCTGGCCAGTCACGGACGGCGACATGCACTGGTCGCTGATTTCCGCGA
TGAACCTGAACTACCTCTCCCTGCTGGACAGGGAGACACTGATCCAGATCCTGCGGACCTTCGACCTGCC
AGGTGCTCACCATCCGCAGCGGGCCAGACTGTCACGCCAGAAACTGGATGCCATAGAAAAACTCGAAACC
AAACCTGTTGACAGGTTGTTTAAAGGCGTACCGGTTCGCGGGCTGGCGACCACGCTGTGGATACGTCCCG
ATCCGTTTATCTGCGAAGGTGAAATTTATCTTCTGGGTACCGTGCTCTCGCACTTCTTTGCCCTCTACGC
CAGCATCAATTCGTACCACTGTCTGAAAATCATTAACACGGAAAGTCAGGAGTCCTGGGAATGGCAGGAG
AAAATGGGCCAGCACGCCCTGATATAG