SecReT6
Protein ID: 611963716
SecReT6 ID905
T6SS typei1
Gene symbolxmtN
Locus tagxmtN
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678350] [Browse all T6SS(s) in this replicon]
Location [Strand]17613..18140 [-]
ProductXmtN
NoteTssC
UniProt IDX5FWL6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.50E-71, Aligned region: 2..173
Protein Sequence: 175 a.a.     [Download]
>gi|611963716|ref|AHW84515.1| XmtN [Escherichia coli]
MGQMQAKIPTEVLITDRREYELAEEGFITLTMRKGSDNACFFSANSVQKPKTFPKTPEGKAAETNYKLGT
QLPYLFVISRLAHYIKVIQREQLGSWKERSDLERELNTWIRQYVADQENPPAEVRSHRPLRQAKIEVLDV
DGEPGWYQVAISVRPHFKYMGASFDLSLVGRLDKE
 
Nucleotide Sequence: 528 bp     [Download]
>gi|611963702|gb|KF678350|xmtN|:17613-18140
ATGGGGCAAATGCAGGCAAAAATTCCGACTGAAGTGTTGATCACTGACCGGAGAGAGTATGAGCTGGCGG
AAGAGGGCTTTATCACACTGACCATGCGTAAAGGGTCTGATAATGCGTGCTTTTTCTCGGCCAACTCGGT
GCAGAAACCCAAAACATTCCCCAAAACCCCCGAAGGCAAGGCTGCGGAGACCAACTATAAACTCGGCACC
CAGCTGCCATACTTGTTTGTTATCAGCAGGTTAGCGCATTACATCAAGGTAATTCAGCGCGAACAGCTTG
GCTCATGGAAAGAACGTAGTGACCTGGAGCGTGAGCTGAACACCTGGATTCGCCAGTATGTTGCTGACCA
GGAAAATCCGCCTGCCGAAGTCCGCAGCCACCGGCCTTTGCGTCAGGCTAAGATCGAGGTACTGGATGTG
GATGGTGAGCCGGGCTGGTACCAGGTCGCGATTTCTGTCAGACCGCATTTTAAATACATGGGTGCCAGTT
TCGACCTGAGCCTGGTCGGACGACTGGATAAGGAATAA