SecReT6
Protein ID: 611963718
SecReT6 ID905
T6SS typei1
Gene symbolxmtP
Locus tagxmtP
StrainEscherichia coli strain TW-XM
Repliconchromosome [GenBank: KF678350] [Browse all T6SS(s) in this replicon]
Location [Strand]19121..19624 [-]
ProductXmtP
NoteTssB
UniProt IDQ6TKV1
KEGG IDelf:LF82_027
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-48, Aligned region: 10..162
Protein Sequence: 167 a.a.     [Download]
>gi|611963718|ref|AHW84517.1| XmtP [Escherichia coli]
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIAINRYNLNAVI
SEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRLLELREALVALKSPLGNIPAF
RAQLQALLENEDTREQLIQELGIAVQK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|611963702|gb|KF678350|xmtP|:19121-19624
ATGAGCAAAATGAACAACAATGGCGGCAGTGTCGCGCCGAAAGAAAGAATCAGCGTTCGGTATACACCAA
AAGTTGATGGGGTGGCTGCTGATATCGAATTGCCGCTGAATTTATTGATCACCGGCAATCTGAAAGGGAA
ACCAGATAACACGCCGTTGGATGAGCGAACTGCCATTGCTATCAACCGCTATAACCTCAACGCAGTCATT
TCAGAAGCTGACATTGAACGGGAGTTTGTTGTTCCGGCTGAACTCAGTGACGCTCCCAATGAGCAAATGT
ACGTCAACCTGAAAGTCAAATCTATGGATGACCTTTCTCCTGACCATATTGCCAGCCAGGTACCAGAAAT
AAAACGTCTGCTCGAATTGCGTGAAGCCCTAGTCGCACTTAAGTCTCCACTAGGCAATATTCCAGCCTTC
CGCGCACAACTTCAGGCGCTACTGGAAAACGAAGACACCCGCGAGCAGCTGATCCAGGAACTGGGTATCG
CCGTTCAGAAATAA