SecReT6
Protein ID: 62178833
SecReT6 ID85
T6SS typei3
Gene symbol-
Locus tagSC0263
StrainSalmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
Repliconchromosome [GenBank: NC_006905] [Browse all T6SS(s) in this replicon]
Location [Strand]302632..304515 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ57SZ2
KEGG IDsec:SC0263
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-210, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|62178833|ref|YP_215250.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPYVERMIEAFSFLSARTQLKIDAEFPR
FTQRLLEVVSPNYVTPTPSMAVVKLYPDTQEGDLAKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWP
LSIEEVRLTAAPPDMPALHRYLPPNIHVAGALRITLRTFGELTFSELAGPARLPFYLCGEERIASHLFEL
LHTSAVATLAGEPGHFDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTG
LSAGLQKVQGNVAEIVILLNRLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRIEVTHSVTEQHLVVDRT
RPLDYEVFSVQEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRREPRRSSENARRYGTRTPYTGSE
VFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRNGRDDLTVDAAIPVAGVGLIRPPRPPQPPLAER
EMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLV
YGRGVSCELTVDEEGFSGISPYLFGLVLEHYIAHHVSINTFSQMTLHSMQRGHVMTWPVRTGQRGSV
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|62178570|ref|NC_006905.1|:c304515-302632 Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 chromosome, complete genome
ATGGATCCACGGCTACTGGAGTATTACAACCGCGAACTGAGCTACCTGCGGGAGACCGGTGCTGAGTTCG
CCACCCTCCATCCCAAAATTGCCGCCCGGCTGGGGATGCAGGGAACCGATATTGCCGACCCGTATGTGGA
ACGCATGATCGAGGCGTTCAGCTTTCTGAGCGCCCGCACTCAGCTAAAAATTGACGCCGAGTTTCCCCGC
TTCACACAGCGGTTACTGGAAGTCGTCAGCCCCAATTACGTCACCCCCACGCCATCGATGGCAGTGGTAA
AGCTGTATCCTGATACGCAGGAAGGCGACCTGGCGAAAGGGGTCACCGTGCCGCGCGATACCGCGTTCGT
TTCCCCCATCCCGGAAGGCGAAAATACCGCCTGCCAGTTTCGCAGCAGCCAGGACGTCACGCTGTGGCCG
CTGTCCATCGAGGAGGTACGCCTGACCGCCGCGCCGCCGGATATGCCCGCCCTGCACCGCTATCTGCCGC
CTAATATTCATGTCGCCGGGGCATTGCGCATCACCCTGCGAACCTTCGGGGAACTGACTTTCAGCGAGCT
GGCCGGTCCGGCACGGCTGCCCTTTTACCTCTGCGGCGAAGAACGCATTGCGTCACACCTGTTTGAGCTG
CTGCATACCAGCGCCGTCGCCACACTGGCCGGTGAACCCGGTCACTTTGACGGCGAACTGAATGTGAATC
TTCAACACCCGGTGGCGCACGAAGGGCTGGAGCCAGGGCAGGGGCTGCTGCCGCTCGCCTGGAACGTGTT
TCACGGCCATAATCTGCTGCATGAATTTTTCGCCTGCCCGGAACGGTTTTACTTCTTCACCCCGACCGGA
TTGTCTGCCGGGTTACAAAAGGTGCAGGGCAATGTGGCGGAAATTGTCATACTGCTTAACCGCCTGCCGC
CGGACTGGCTGATTCATCAGACGGACGCTGCACAGTTCAGCCTGTTCTGTACGCCGGTGATCAACCTGTT
TCCTCGCACCACCACCCGGATTGAAGTCACTCACAGCGTGACGGAACAGCATCTGGTGGTGGATCGTACC
CGTCCGCTGGATTACGAGGTGTTTTCTGTTCAGGAAGTCGAAGGCCTGGAAGCGGAAACCACACGGAAGA
TGATTTTTCGTCCGCTGTATCACACCCGTAATAATGACGAAGGCAACCACGGGCGTTATTTTTCACTGCG
TCGTGAACCGCGCCGCTCGTCAGAAAACGCCCGCCGCTATGGCACCCGAACCCCCTATACCGGCTCGGAA
GTCTTCCTGTCGCTGGTTGATCAGCATGAAGCGCCCTACCCGGAAAATCTGCGCCATATCACCGTCACGG
CAATGGTGACTAACCGCGATCTGCCCTGCCTTATTCCACGTAATGGCCGGGATGATCTGACCGTTGATGC
GGCGATTCCGGTGGCGGGCGTGGGTCTTATCAGACCGCCGCGCCCGCCGCAGCCGCCGCTGGCTGAACGC
GAAATGGCCTGGCGGCTGATCCGGCAGTTGTCGTTTAATTATCTGCCGCTGGCCGATCTGGATCACCGCA
CCGGCGGCCAGGCGCTGCGCGATCTGCTGAATCTGTTTATCCCGGCTCACGACAGCCCGCAGTCGCGCCA
GGTGCGCAGCCTGATTGGCTGCAAAACCACCCCGGTGACCCGCCGACTGCCCGGCTCCGGCCTGTTGGTC
TATGGCCGGGGCGTCAGTTGCGAACTGACCGTGGACGAAGAAGGATTTTCCGGTATCAGTCCTTACCTGT
TCGGTCTGGTGCTGGAACACTATATTGCCCACCATGTTTCCATTAATACCTTCTCGCAGATGACGCTGCA
CTCGATGCAACGCGGGCATGTCATGACCTGGCCGGTCAGAACCGGGCAACGGGGGAGCGTATGA