SecReT6
Protein ID: 62178835
SecReT6 ID85
T6SS typei3
Gene symbol-
Locus tagSC0265
StrainSalmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
Repliconchromosome [GenBank: NC_006905] [Browse all T6SS(s) in this replicon]
Location [Strand]305022..305771 [-]
Producthypothetical protein
NoteTagJ
UniProt IDQ57SZ0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.30E-46, Aligned region: 94..114
ImpE [PF07024], Evalue: 8.30E-46, Aligned region: 118..241
Protein Sequence: 249 a.a.     [Download]
>gi|62178835|ref|YP_215252.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
MAEQQVRENPAKALCRHSLFQLLCVAGDWSRALHQLQLCARMEANYTQEARLYRELVRCEMFRHTVFQGE
QRPGFLLPQPVWVESLLAALACHDDIGEVDKHRNTALEAITDTGGQWNGGAFDWASDSDSRLGPVLELVT
GGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWLFTRYSGSESASDALRLCRETAWQDG
PGETTVRALGQKVWMTSHGDISLLDMAHCTFHAQENDGA
 
Nucleotide Sequence: 750 bp     [Download]
>gi|62178570|ref|NC_006905.1|:c305771-305022 Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 chromosome, complete genome
ATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAAGCGCTCTGCCGCCACAGCCTGTTTCAGTTGCTGT
GTGTGGCCGGAGACTGGTCGCGGGCGCTACACCAGCTTCAGCTATGCGCCAGGATGGAGGCCAATTATAC
CCAGGAGGCCCGGCTGTACCGGGAGCTGGTTCGCTGCGAAATGTTCCGCCACACCGTTTTTCAGGGTGAA
CAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCTGGCGGCACTCGCCTGTCATG
ACGATATCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATAACAGACACGGGCGGGCAGTG
GAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCCCGGTACTTGAGCTAGTCACC
GGCGGCGTGTATATCTGGCTGCCGTTTTCGCAAATACGCTCGCTGGAATCGCCGCAACCGACGCGCCTGA
CCGATCTGCTGTGGAAACCCGTTAATATCACCCTTGTGAATGGCGATACGCACGGCGCCTGGCTCTTTAC
CCGCTACAGCGGTTCGGAAAGTGCATCTGACGCCCTGCGTCTGTGCCGGGAAACCGCCTGGCAGGACGGC
CCCGGCGAAACCACCGTGCGGGCGCTGGGGCAGAAAGTGTGGATGACCAGCCACGGCGATATCAGCCTGC
TGGACATGGCCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA