SecReT6
Protein ID: 62178838
SecReT6 ID85
T6SS typei3
Gene symbol-
Locus tagSC0268
StrainSalmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
Repliconchromosome [GenBank: NC_006905] [Browse all T6SS(s) in this replicon]
Location [Strand]309841..310383 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ57SY7
KEGG IDsec:SC0268
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.00E-60, Aligned region: 11..163
Protein Sequence: 180 a.a.     [Download]
>gi|62178838|ref|YP_215255.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKPAATQQGVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|62178570|ref|NC_006905.1|:309841-310383 Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 chromosome, complete genome
ATGGCTATCAACAATAGCGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGCTCTGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
CGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGCATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCTGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACGCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACCCAACTGGCGAACCTCCAGACCTACATGGATGGTAAGGCC
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACCCTGCTGAAAACGCTAGCGAATGCGCCGA
AACCGGCCGCTACCCAGCAAGGTGTGTCAGCGGATAATGAATCAGCGGAATAA