SecReT6
Protein ID: 62178842
SecReT6 ID85
T6SS typei3
Gene symbol-
Locus tagSC0272
StrainSalmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
Repliconchromosome [GenBank: NC_006905] [Browse all T6SS(s) in this replicon]
Location [Strand]313079..313564 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ57SY3
KEGG IDsec:SC0272
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-40, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|62178842|ref|YP_215259.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
MAYDIFLKIDGIDGESMDDKHKNEIEVLGWRWNIHQESTMHAGSGLGSGKVSVTNLEFEHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGNREGEIASRERIELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|62178570|ref|NC_006905.1|:313079-313564 Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 chromosome, complete genome
ATGGCTTATGACATTTTTTTGAAAATTGACGGCATTGACGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGGGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGTGGCCTCGG
CTCCGGTAAGGTCTCTGTCACTAATCTGGAATTCGAGCATTATATCGATCGCGCCAGCCCGAATCTGTTC
AAATACTGTGCCTCCGGTAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAACCCGT
TGGAGTACCTCAAGTACACCTTTACCGATCTGATCGTTGCGGTCGTTTCACCTAGCGGTAACAGAGAAGG
CGAAATCGCGTCTCGCGAGCGGATTGAGCTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGTGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA