SecReT6
Protein ID: 62178843
SecReT6 ID85
T6SS typei3
Gene symbol-
Locus tagSC0273
StrainSalmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
Repliconchromosome [GenBank: NC_006905] [Browse all T6SS(s) in this replicon]
Location [Strand]313631..314167 [+]
Productouter membrane lipoprotein
NoteTssJ
UniProt IDQ57SY2
KEGG IDsec:SC0273
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-41, Aligned region: 20..170
Protein Sequence: 178 a.a.     [Download]
>gi|62178843|ref|YP_215260.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
MDEWRNPTRWLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKN
DAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYK
IPEAPEKAWYSSFIPGKGKVQLEAELEQSAIVITERDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|62178570|ref|NC_006905.1|:313631-314167 Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 chromosome, complete genome
GTGGATGAATGGCGTAACCCCACTCGGTGGTTATGTGCGGTAGCTATGCCTTTTGCACTGCTCCTGCTTT
CCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGCGACTCGACCTGAGCGTGAAAGCCTC
CGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGAGATACGTGTTTATGAACTAAAAAAT
GACGCCGCTTTCACGACAGCTGATTACTGGTCGCTCCATGACAACGACAAATCCGTCCTTACCGACGATT
TAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAAAACTGCGTCGCCCGCTGAATGCGCA
GACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAAATCGGTCTGGCGGGTAACCTACAAA
ATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAGCTTCATACCGGGGAAAGGAAAAGTGCAGTTGGAGG
CGGAACTGGAACAAAGCGCCATTGTAATTACGGAACGGGATAAATGA