SecReT6
Protein ID: 66048177
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4953
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5871317..5871850 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ4ZLJ2
KEGG IDpsb:Psyr_4953
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.70E-60, Aligned region: 11..165
Protein Sequence: 177 a.a.     [Download]
>gi|66048177|ref|YP_238018.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MAKKESTQHKLDRVRAPRVHITYDVDIGDAQEKKELPFVVGVLGDFSGNPLEPLPKLKDRKFIFIDRDNF
NGVLKGIKPRLAYRVDNTLAKDGTQLGVELNFNALEDFEPQNVVRQVEPLRKLLEVRNKLADLRNKMGGN
DKLEELLMDVLQNTEKLKTLGKEFGREAAVPATDSKE
 
Nucleotide Sequence: 534 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5871317-5871850 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGGCGAAGAAGGAAAGTACCCAGCACAAACTTGACCGCGTTCGCGCGCCTCGGGTCCATATCACTTACG
ACGTGGACATCGGCGATGCTCAGGAAAAGAAAGAGCTGCCATTCGTTGTAGGCGTTCTGGGCGATTTCTC
CGGCAACCCGCTGGAGCCGCTGCCCAAGCTCAAGGATCGCAAGTTCATCTTCATCGACCGCGACAACTTC
AACGGCGTCCTGAAAGGCATCAAGCCGCGCCTGGCGTATCGCGTCGACAACACCCTGGCAAAAGACGGCA
CGCAACTCGGTGTCGAGCTGAACTTCAATGCGCTGGAAGACTTCGAGCCGCAGAACGTCGTGCGTCAGGT
CGAGCCGCTGCGCAAGCTGCTGGAAGTGCGTAACAAGCTGGCTGACCTGCGTAACAAGATGGGTGGCAAC
GACAAGCTTGAAGAGCTGCTGATGGACGTGTTGCAGAACACTGAAAAGCTGAAAACCCTGGGCAAGGAAT
TCGGCCGTGAAGCCGCCGTTCCCGCCACCGACAGCAAAGAGTAA