SecReT6
Protein ID: 66048178
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4954
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5871865..5873367 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ4ZLJ1
KEGG IDpsb:Psyr_4954
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-195, Aligned region: 73..495
Protein Sequence: 500 a.a.     [Download]
>gi|66048178|ref|YP_238019.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MTDKQPVTQQDSALVEVENFAPQSSLLDSIISESRVARSETERTRTRDLIGELVAQVLEGEMTPSKDLIA
VLDARIAEIDSMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKASSE
FDQSALFKKIYEEEYGTFGGAPFGMLLGDYEFNRSPEDMYLLEEISHVAAAAHAPFISAASAELFGWDSF
TDMAGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKY
LWMNAAYALGTRVTDAFSRYGWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKGTDYAAFFGTQSTQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RKDVELFLNKWLSSYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRL
VAELPQSTRG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5871865-5873367 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGACCGATAAGCAACCCGTGACTCAGCAGGACAGCGCTCTGGTTGAAGTGGAAAACTTCGCCCCGCAAT
CTTCCTTGCTCGACAGCATCATTTCCGAAAGCCGCGTTGCACGCTCCGAAACCGAGCGCACCCGTACCCG
CGATCTGATCGGCGAACTGGTGGCCCAGGTACTTGAAGGCGAGATGACGCCGAGCAAGGACCTGATTGCC
GTGCTCGACGCGCGCATCGCCGAGATCGATTCGATGCTCTCCGAGCAAATGAACGAAATCATGCACGCCC
GTGAATTCCAGCAGCTGGAAGCATCCTGGCGCGGCCTGAAGTATCAGGTTGACCAGACCGAGACCAGCAC
CACGCTGAAGATCCACCTGCTCAACGCGTCGAAAAAAGACCTCGTGCGTGACCTCAAGGCATCGTCCGAA
TTCGACCAGAGCGCACTGTTCAAGAAGATCTACGAAGAAGAGTACGGCACCTTCGGTGGTGCGCCGTTCG
GCATGCTGCTGGGTGACTACGAGTTCAACCGCAGCCCGGAAGACATGTACCTGCTGGAAGAGATCTCCCA
CGTGGCAGCTGCCGCCCACGCGCCGTTCATTTCGGCTGCATCGGCTGAACTGTTCGGCTGGGACTCGTTC
ACCGACATGGCCGGCCCTCGCGACCTGGCGAAGATCTTCGACACCGTCGAATACGCCAAGTGGAAGTCGT
TCCGCGCCTCCGAAGACTCCCGCTATGTCGGCCTGACCCTGCCGCACGTGCTGGGTCGCCTGCCGTATGG
CCCGGATACCACGCCTGTCGAAGAATTCAACTTCGTCGAAAGCGTCGATGGCCGTGACCACAACAAATAC
CTGTGGATGAACGCTGCCTACGCGCTGGGCACTCGTGTGACCGACGCATTCTCCCGCTACGGCTGGTGCG
TGGCGATCCGTGGTGTGGAAGGCGGTGGTCTGGTCGAAGGCCTGCCGACTCATACCTTCAAGACCGATGA
CGGTGAAATCGCGCTCAAATGCCCGACTGAAATCGCCATCACCGACCGTCGCGAAAAAGAGCTCTCGGAC
CTCGGCTTCATTCCGCTGGTGCACTGCAAAGGTACCGACTACGCCGCGTTCTTCGGCACCCAGTCGACCC
AGAAGCAGAAGCAGTACAACACCGACATTGCCAACGCCAACGCACGTCTGTCGGCGCAGCTGCAATACAT
CTTCGCGACCTCGCGTATCGCTCACTACATGAAAGCGATCATGCGCGACAAGATCGGCAGTTTTGCATCG
CGCAAGGATGTCGAGCTGTTCCTCAACAAGTGGCTGTCCAGCTACGTGTTGCTGGATGACACCGCCAGCC
AGGAAGCCAAGGCCAAGTTCCCGCTGCGCGAGGCGCGTGCCGAAGTGTTCGAAGTCCCTGGCAAGCCTGG
CGTCTACAAGGCCGTGACTTACCTGCGTCCGCATTACCAACTGGATGAACTGACGGCATCGCTGCGTCTG
GTCGCCGAATTGCCGCAATCGACACGCGGCTAA