SecReT6
Protein ID: 66048179
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4955
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5873395..5873877 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ4ZLJ0
KEGG IDpsb:Psyr_4955
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.00E-17, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|66048179|ref|YP_238020.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MSSQHKLLPSLLDRLLDDRPHQSVESSSQRLSSLADYKASIVRDLEILVNTRQSLVAGELEGFANLSGTI
LDYGMPDFTSRSVLDPQDRLLIQRQLEKAISVGDRRFRSVKVQLLAQQTGQRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5873395-5873877 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGAGTAGTCAACACAAGCTGTTGCCTTCATTGCTGGATCGATTGCTCGACGATCGTCCGCATCAGTCCG
TGGAATCGTCATCGCAACGGTTGAGCTCGCTGGCCGATTACAAGGCCAGCATCGTGCGTGACCTGGAGAT
TCTGGTGAACACTCGCCAGTCTCTGGTCGCTGGCGAGCTGGAAGGTTTCGCCAATCTGAGCGGCACCATC
CTCGACTACGGTATGCCCGACTTCACCAGTAGAAGCGTGCTCGACCCACAGGACCGGCTTTTGATCCAGC
GCCAGCTGGAAAAGGCCATCTCGGTGGGCGACCGACGCTTTCGCAGCGTGAAAGTCCAGTTGCTTGCACA
ACAGACCGGCCAACGCATGCTGACTTTTCGTGTGGACGCAGTACTGCGTCTGCAGGACATTTCGCGTCAG
GTTTCCTTTGACGCCGTGCTGCAGGTCAACACTCAGGAATACAAAGTGCAGAACCTCAACTGA