SecReT6
Protein ID: 66048180
SecReT6 ID86
T6SS typei4b
Gene symbol-
Locus tagPsyr_4956
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T6SS(s) in this replicon]
Location [Strand]5873877..5875709 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ4ZLI9
KEGG IDpsb:Psyr_4956
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.60E-211, Aligned region: 5..610
Protein Sequence: 610 a.a.     [Download]
>gi|66048180|ref|YP_238021.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MLDDLLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARVHKKLDDEFPE
IVESFLEVLYPHYLRPTPSMSIVEFNMGKQEKVTESYRVARHTELHANPVDGIVCKFRTCYPVELWPIAV
QSASFIEMERSAFNGHSADLIARLRIGLTATSDVLFGKMEMDSLRFFLDGESTLMHQLYELLFNNLAKAT
LSFEDEGRTREVVLPAGALKSVGYGLDEGLVDYSERSFLGYRLLHEYFTFPDKFMFFDLSGFARILAGKE
IGKVEINFYFSDYDLTDRLARLTQNVSRNNFKLNCTPIINLFRQQAEPIKLTHVQHEYAVTPDVRLQSSA
EVVSIDRVRRVKKINGNDQVGTCHPFFEPRGDQGPGQSFWIARRRPTQSRQSDGSNMFIRVVDRDLELID
SNNDTLSIRLTCSNRDLPLMLPFGGERGDFNIPSNSVIKDIRCLRKPTATVRVPLGNGVIWRLISHLSLN
HMSLVSKGREVLLELLSLYNYRNVSAIRKQINGIVSVSSEPVVARIGHPRPNFVRGVGITLKFDESQYTG
SGVFLFGMVLDHFFGQYCSMNSFTQLTLRTLQREKRVVQWPPRTGDQPLV
 
Nucleotide Sequence: 1833 bp     [Download]
>gi|66043271|ref|NC_007005.1|:5873877-5875709 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGCTCGACGATCTGCTGCCCTATTACGAGAAGGAACTCTCGCACCTGCGCTTTCTGGGCCAGGAATTTG
CCGCTCAATATCCGAAGATCGCTTCGCGACTGCTGATTGAGGGCGACAACTGCGAGGACCCGCACACCGA
GCGCCTGATCGAGGCGTTCTCGTTCCTGTCGGCTCGCGTGCACAAGAAACTCGATGATGAGTTTCCGGAA
ATCGTCGAGTCGTTCCTCGAGGTGCTGTACCCGCATTACTTGCGCCCTACCCCGTCGATGTCCATCGTCG
AGTTCAACATGGGCAAGCAGGAAAAGGTCACCGAGTCCTATCGTGTGGCGCGACACACCGAACTGCACGC
CAATCCGGTGGACGGCATCGTGTGCAAGTTCCGGACGTGCTACCCGGTCGAGCTATGGCCGATTGCCGTG
CAGAGCGCGTCGTTCATCGAAATGGAACGCTCGGCGTTCAACGGCCACAGCGCAGACCTGATTGCACGTC
TGCGCATTGGTCTGACGGCCACCTCCGACGTGCTGTTCGGCAAGATGGAAATGGACAGCCTGCGCTTTTT
CCTCGATGGCGAAAGCACGCTCATGCATCAACTGTATGAGCTGCTGTTCAACAACCTGGCCAAGGCCACG
CTGTCCTTCGAAGACGAAGGCCGCACTCGCGAAGTGGTGCTGCCCGCCGGCGCCTTGAAGTCTGTCGGTT
ACGGTCTGGATGAAGGGCTGGTGGATTACTCGGAGCGTTCGTTTCTCGGTTATCGGTTGCTGCACGAGTA
CTTCACCTTCCCGGACAAGTTCATGTTCTTCGACCTGTCGGGCTTTGCGCGCATTCTGGCGGGCAAAGAG
ATCGGCAAAGTGGAGATCAATTTCTACTTTTCCGACTACGACCTGACGGACCGTCTGGCGCGCCTGACGC
AGAACGTCAGCCGCAACAATTTCAAGCTCAACTGCACGCCGATCATCAACCTGTTCCGCCAGCAGGCCGA
GCCGATCAAGCTGACCCACGTCCAGCATGAATACGCTGTCACGCCGGATGTGCGCCTGCAAAGCTCCGCC
GAAGTGGTCTCGATCGATCGCGTGCGCCGGGTCAAGAAGATCAATGGCAACGACCAGGTCGGCACCTGCC
ATCCGTTCTTCGAACCACGCGGCGATCAAGGCCCGGGACAGAGTTTCTGGATCGCCCGGCGCCGGCCGAC
GCAGAGCCGGCAAAGTGACGGCTCAAACATGTTCATCCGGGTCGTGGATCGGGATCTGGAGCTGATCGAT
TCCAACAATGACACGCTCAGTATCCGTCTGACGTGCAGCAATCGCGACCTGCCATTGATGCTGCCTTTTG
GCGGCGAGCGCGGCGATTTCAACATTCCGTCGAACTCAGTGATCAAGGACATCCGCTGCCTGCGCAAGCC
TACGGCGACGGTGCGCGTGCCGCTGGGCAACGGCGTGATCTGGCGGCTTATTTCGCACCTGTCACTCAAC
CACATGTCGCTGGTTTCCAAGGGACGCGAGGTGCTGCTGGAACTGCTGTCGCTTTACAACTACCGCAACG
TGTCGGCGATCCGCAAACAGATCAACGGGATCGTTTCGGTGAGCAGCGAGCCGGTCGTGGCACGCATCGG
CCATCCGCGGCCGAACTTCGTGCGCGGCGTCGGCATCACGCTGAAGTTCGATGAAAGCCAGTACACCGGC
AGTGGCGTGTTCCTGTTCGGCATGGTGCTTGATCACTTCTTTGGTCAGTACTGCTCGATGAACAGCTTTA
CCCAATTAACCCTTCGCACCTTGCAGCGCGAAAAGAGAGTGGTCCAATGGCCCCCGCGAACAGGCGATCA
ACCCCTGGTCTGA